Quick search:







Description Entry page for G-protein - 'Ggamma-10_Homo sapiens'
ClassGgamma
FamilyGgamma
Sub-FamilyGgamma
TypeGgamma-10
Cross References:
References
UniProtP50151 | Q3B7K2 | Q4VC27
EMBLU31383 | AF493877 | AL135787 | BC010384 | BC015206 | BC016319 | BC072671 | BC107574
InterProIPR015898 | IPR001770
PRODOMPD003783
GENEID2790
MIM604389
PRINTSPR00321
PFAMPF00631
Details:
Details
NameGgamma-10_Homo sapiens
DescriptionRecName: Full=Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-10;Flags: Precursor
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGNG10 | GNGT1
FunctionGuanine nucleotide-binding proteins (G proteins) ares involved as a modulator or transducer in various transmembranes signaling systems
Fragment0
Sequence
MSSGASASALQRLVEQLKLEAGVERIKVSQAAAELQQYCMQNACKDALLVGVPAGSNPFR
EPRSCALL
Effectors:
Effectors
NoNameRegulationPubMed
1Adenylate cyclase 1-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933 | 10449730
2Raf1 protein kinase-Homo sapiensSequestration of G15251227
3Rho-Homo sapiens-2Recruitment to plasma membrane15251227
4Rho-Homo sapiens-3Recruitment to plasma membrane15251227
5Tubulin-Homo sapiens-3Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
6Cdc42-Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
7Tubulin-Homo sapiens-5Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
8Tubulin-Homo sapiens-13Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
9Tubulin-Homo sapiens-23Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
10Ras specific nucleotide exchange factor CDC25-Homo sapiensStimulation (indirect activation of ras)15251227 | 8717044
11Tubulin-Homo sapiens-17Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
12Tubulin-Homo sapiens-11Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
13Tubulin-Homo sapiens-18Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
14GRK2-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
15ATP-sensitive inward rectifier potassium channel 10-Homo sapiensStimulation15251227 | 10990455
16Rho-Homo sapiens-1Recruitment to plasma membrane15251227
17Tubulin-Homo sapiens-14Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
18Tsk tyrosine kinase-Homo sapiensStimulation15251227 | 14671004
19PI3K gamma-Homo sapiensActivation12502714
20Adenylate cyclase 5-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
21PI3K alpha-Homo sapiensPropable Inhibition16182515
22Adenylate cyclase 4-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
23Tubulin-Homo sapiens-20Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
24Tubulin-Homo sapiens-21Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
25Tubulin-Homo sapiens-25Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
26Adenylate cyclase 6-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
27GRK3-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
28Rac-Homo sapiens-3"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
29Voltage dependent R type calcium channel-Homo sapiensInhibition15251227 | 11031246
30Phospholipase C beta 2-Homo sapiensStimulation15251227 | 11015615 | 8383116
31Kinase suppressor of Ras(KSR)-Homo sapiensSequestration of Gbeta/gamma15251227
32Adenylate cyclase 2-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
33Protein kinase D-Homo sapiensStimulation15251227
34ATP-sensitive inward rectifier potassium channel 11-Homo sapiensStimulation15251227 | 10990455
35Tubulin-Homo sapiens-16Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
36Calmodulin-Homo sapiensInhibition of calmodulin kinase15251227
37Rac-Homo sapiens-1"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
38Voltage dependent N type calcium channel-Homo sapiensInhibition15251227 | 11031246
39Tubulin-Homo sapiens-19Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
40Tubulin-Homo sapiens-24Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
41Rac-Homo sapiens-2"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
42Adenylate cyclase 7-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
43Tubulin-Homo sapiens-1Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
44Dynamin 1-Homo sapiensIncreased GTPase activity15251227 | 14671004
45Tubulin-Homo sapiens-22Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
46Brutons tyrosine kinase-Homo sapiensStimulation15251227 | 11698416
47SHC transforming protein 2-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
48ATP-sensitive inward rectifier potassium channel 15-Homo sapiensStimulation15251227 | 10990455
49SHC transforming protein 1-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
50ATP-sensitive inward rectifier potassium channel 12-Homo sapiensStimulation15251227 | 10990455
51Tubulin-Homo sapiens-27Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
52Tubulin-Homo sapiens-4Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
53ATP-sensitive inward rectifier potassium channel 8-Homo sapiensStimulation15251227 | 10990455
54Tubulin-Homo sapiens-9Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
55ATP-sensitive inward rectifier potassium channel 14-Homo sapiensStimulation15251227 | 10990455
56Tubulin-Homo sapiens-10Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
57Tubulin-Homo sapiens-15Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
58Tubulin-Homo sapiens-26Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
59Tubulin-Homo sapiens-8Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
60Tubulin-Homo sapiens-6Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
61Phospholipase C beta 1-Homo sapiensStimulation15251227 | 11015615 | 8383116
62Tubulin-Homo sapiens-7Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
63Tubulin-Homo sapiens-2Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
64SHC transforming protein 3-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
65Voltage dependent P/Q type calcium channel-Homo sapiensInhibition15251227 | 11031246
66ATP-sensitive inward rectifier potassium channel 1-Homo sapiensStimulation15251227 | 10990455
67PI3K beta-Homo sapiensActivation9305878 | 12502714
68Phospholipase C beta 3-Homo sapiensStimulation15251227 | 11015615 | 8383116
69Tubulin-Homo sapiens-12Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
Interacton with GPCRs:
Coupling with GPCRs
NoNameCouplingPubMed