Quick search:







Description Entry page for G-protein - 'Ggamma-10_Homo sapiens'
ClassGgamma
FamilyGgamma
Sub-FamilyGgamma
TypeGgamma-10
Cross References:
References
UniProtP50151 | Q3B7K2 | Q4VC27
EMBLU31383 | AF493877 | AL135787 | BC010384 | BC015206 | BC016319 | BC072671 | BC107574
InterProIPR015898 | IPR001770
PRODOMPD003783
GENEID2790
MIM604389
PRINTSPR00321
PFAMPF00631
Details:
Details
NameGgamma-10_Homo sapiens
DescriptionRecName: Full=Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-10;Flags: Precursor
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGNG10 | GNGT1
FunctionGuanine nucleotide-binding proteins (G proteins) ares involved as a modulator or transducer in various transmembranes signaling systems
Fragment0
Sequence
MSSGASASALQRLVEQLKLEAGVERIKVSQAAAELQQYCMQNACKDALLVGVPAGSNPFR
EPRSCALL
Effectors:
Effectors
NoNameRegulationPubMed
1Tubulin-Homo sapiens-15Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
2ATP-sensitive inward rectifier potassium channel 10-Homo sapiensStimulation15251227 | 10990455
3Rac-Homo sapiens-1"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
4Tsk tyrosine kinase-Homo sapiensStimulation15251227 | 14671004
5Rho-Homo sapiens-1Recruitment to plasma membrane15251227
6Tubulin-Homo sapiens-18Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
7Tubulin-Homo sapiens-26Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
8Tubulin-Homo sapiens-6Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
9Kinase suppressor of Ras(KSR)-Homo sapiensSequestration of Gbeta/gamma15251227
10SHC transforming protein 2-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
11Voltage dependent P/Q type calcium channel-Homo sapiensInhibition15251227 | 11031246
12Tubulin-Homo sapiens-24Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
13Dynamin 1-Homo sapiensIncreased GTPase activity15251227 | 14671004
14Adenylate cyclase 1-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933 | 10449730
15Tubulin-Homo sapiens-12Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
16PI3K alpha-Homo sapiensPropable Inhibition16182515
17ATP-sensitive inward rectifier potassium channel 1-Homo sapiensStimulation15251227 | 10990455
18Tubulin-Homo sapiens-10Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
19Tubulin-Homo sapiens-13Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
20Tubulin-Homo sapiens-3Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
21SHC transforming protein 3-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
22ATP-sensitive inward rectifier potassium channel 14-Homo sapiensStimulation15251227 | 10990455
23Phospholipase C beta 1-Homo sapiensStimulation15251227 | 11015615 | 8383116
24Tubulin-Homo sapiens-23Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
25ATP-sensitive inward rectifier potassium channel 11-Homo sapiensStimulation15251227 | 10990455
26Rac-Homo sapiens-2"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
27Phospholipase C beta 2-Homo sapiensStimulation15251227 | 11015615 | 8383116
28Tubulin-Homo sapiens-7Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
29Rho-Homo sapiens-3Recruitment to plasma membrane15251227
30Tubulin-Homo sapiens-1Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
31Adenylate cyclase 5-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
32Adenylate cyclase 4-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
33Adenylate cyclase 6-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
34Tubulin-Homo sapiens-19Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
35Tubulin-Homo sapiens-8Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
36ATP-sensitive inward rectifier potassium channel 15-Homo sapiensStimulation15251227 | 10990455
37Tubulin-Homo sapiens-9Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
38GRK2-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
39ATP-sensitive inward rectifier potassium channel 12-Homo sapiensStimulation15251227 | 10990455
40Adenylate cyclase 7-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
41Ras specific nucleotide exchange factor CDC25-Homo sapiensStimulation (indirect activation of ras)15251227 | 8717044
42Tubulin-Homo sapiens-4Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
43Voltage dependent N type calcium channel-Homo sapiensInhibition15251227 | 11031246
44Tubulin-Homo sapiens-11Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
45Phospholipase C beta 3-Homo sapiensStimulation15251227 | 11015615 | 8383116
46Adenylate cyclase 2-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
47Tubulin-Homo sapiens-20Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
48ATP-sensitive inward rectifier potassium channel 8-Homo sapiensStimulation15251227 | 10990455
49Tubulin-Homo sapiens-25Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
50GRK3-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
51Brutons tyrosine kinase-Homo sapiensStimulation15251227 | 11698416
52Voltage dependent R type calcium channel-Homo sapiensInhibition15251227 | 11031246
53Rho-Homo sapiens-2Recruitment to plasma membrane15251227
54Tubulin-Homo sapiens-5Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
55Tubulin-Homo sapiens-17Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
56Tubulin-Homo sapiens-16Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
57PI3K beta-Homo sapiensActivation9305878 | 12502714
58Tubulin-Homo sapiens-14Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
59Calmodulin-Homo sapiensInhibition of calmodulin kinase15251227
60SHC transforming protein 1-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
61Tubulin-Homo sapiens-27Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
62Cdc42-Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
63PI3K gamma-Homo sapiensActivation12502714
64Raf1 protein kinase-Homo sapiensSequestration of G15251227
65Tubulin-Homo sapiens-2Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
66Rac-Homo sapiens-3"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
67Tubulin-Homo sapiens-22Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
68Tubulin-Homo sapiens-21Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
69Protein kinase D-Homo sapiensStimulation15251227
Interacton with GPCRs:
Coupling with GPCRs
NoNameCouplingPubMed