Quick search:







Description Entry page for G-protein - 'Ggamma-11_Homo sapiens'
ClassGgamma
FamilyGgamma
Sub-FamilyGgamma
TypeGgamma-11
Cross References:
References
UniProtP61952 | P50152
EMBLU31384 | AF493878 | AC002076 | BC009709
InterProIPR015898 | IPR001770
PRODOMPD003783
GENEID2791
MIM604390
PRINTSPR00321
PFAMPF00631
Details:
Details
NameGgamma-11_Homo sapiens
DescriptionRecName: Full=Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11;Flags: Precursor
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGNG11 | GNGT1
FunctionGuanine nucleotide-binding proteins (G proteins) ares involved as a modulator or transducer in various transmembranes signaling systems
Fragment0
Sequence
MPALHIEDLPEKEKLKMEVEQLRKEVKLQRQQVSKCSEEIKNYIEERSGEDPLVKGIPED
KNPFKEKGSCVIS
Effectors:
Effectors
NoNameRegulationPubMed
1Tubulin-Homo sapiens-2Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
2Tubulin-Homo sapiens-16Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
3Tubulin-Homo sapiens-17Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
4ATP-sensitive inward rectifier potassium channel 12-Homo sapiensStimulation15251227 | 10990455
5Tubulin-Homo sapiens-22Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
6Adenylate cyclase 7-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
7Phospholipase C beta 1-Homo sapiensStimulation15251227 | 11015615 | 8383116
8SHC transforming protein 1-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
9Rho-Homo sapiens-2Recruitment to plasma membrane15251227
10Tubulin-Homo sapiens-19Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
11Phospholipase C beta 2-Homo sapiensStimulation15251227 | 11015615 | 8383116
12PI3K beta-Homo sapiensActivation9305878 | 12502714
13Voltage dependent P/Q type calcium channel-Homo sapiensInhibition15251227 | 11031246
14ATP-sensitive inward rectifier potassium channel 10-Homo sapiensStimulation15251227 | 10990455
15Rho-Homo sapiens-1Recruitment to plasma membrane15251227
16Tubulin-Homo sapiens-15Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
17Tubulin-Homo sapiens-23Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
18Adenylate cyclase 4-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
19Adenylate cyclase 6-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
20Tubulin-Homo sapiens-6Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
21Tubulin-Homo sapiens-5Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
22Tsk tyrosine kinase-Homo sapiensStimulation15251227 | 14671004
23PI3K gamma-Homo sapiensActivation12502714
24Tubulin-Homo sapiens-10Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
25Tubulin-Homo sapiens-24Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
26Cdc42-Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
27Tubulin-Homo sapiens-8Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
28ATP-sensitive inward rectifier potassium channel 15-Homo sapiensStimulation15251227 | 10990455
29PI3K alpha-Homo sapiensPropable Inhibition16182515
30Tubulin-Homo sapiens-7Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
31Tubulin-Homo sapiens-3Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
32Tubulin-Homo sapiens-21Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
33Tubulin-Homo sapiens-27Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
34Phospholipase C beta 3-Homo sapiensStimulation15251227 | 11015615 | 8383116
35Tubulin-Homo sapiens-4Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
36Protein kinase D-Homo sapiensStimulation15251227
37Rac-Homo sapiens-2"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
38Tubulin-Homo sapiens-26Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
39Calmodulin-Homo sapiensInhibition of calmodulin kinase15251227
40Rho-Homo sapiens-3Recruitment to plasma membrane15251227
41Rac-Homo sapiens-3"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
42GRK2-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
43Rac-Homo sapiens-1"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
44ATP-sensitive inward rectifier potassium channel 8-Homo sapiensStimulation15251227 | 10990455
45Voltage dependent R type calcium channel-Homo sapiensInhibition15251227 | 11031246
46Tubulin-Homo sapiens-20Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
47Adenylate cyclase 2-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
48Tubulin-Homo sapiens-1Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
49Tubulin-Homo sapiens-13Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
50Adenylate cyclase 5-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
51Ras specific nucleotide exchange factor CDC25-Homo sapiensStimulation (indirect activation of ras)15251227 | 8717044
52Tubulin-Homo sapiens-25Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
53Tubulin-Homo sapiens-12Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
54Dynamin 1-Homo sapiensIncreased GTPase activity15251227 | 14671004
55Tubulin-Homo sapiens-18Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
56ATP-sensitive inward rectifier potassium channel 14-Homo sapiensStimulation15251227 | 10990455
57ATP-sensitive inward rectifier potassium channel 1-Homo sapiensStimulation15251227 | 10990455
58ATP-sensitive inward rectifier potassium channel 11-Homo sapiensStimulation15251227 | 10990455
59SHC transforming protein 2-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
60Adenylate cyclase 1-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933 | 10449730
61Raf1 protein kinase-Homo sapiensSequestration of G15251227
62Tubulin-Homo sapiens-14Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
63Tubulin-Homo sapiens-9Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
64Kinase suppressor of Ras(KSR)-Homo sapiensSequestration of Gbeta/gamma15251227
65Tubulin-Homo sapiens-11Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
66SHC transforming protein 3-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
67GRK3-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
68Brutons tyrosine kinase-Homo sapiensStimulation15251227 | 11698416
69Voltage dependent N type calcium channel-Homo sapiensInhibition15251227 | 11031246
Interacton with GPCRs:
Coupling with GPCRs
NoNameCouplingPubMed