Quick search:







Description Entry page for G-protein - 'Ggamma-11_Homo sapiens'
ClassGgamma
FamilyGgamma
Sub-FamilyGgamma
TypeGgamma-11
Cross References:
References
UniProtP61952 | P50152
EMBLU31384 | AF493878 | AC002076 | BC009709
InterProIPR015898 | IPR001770
PRODOMPD003783
GENEID2791
MIM604390
PRINTSPR00321
PFAMPF00631
Details:
Details
NameGgamma-11_Homo sapiens
DescriptionRecName: Full=Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11;Flags: Precursor
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGNG11 | GNGT1
FunctionGuanine nucleotide-binding proteins (G proteins) ares involved as a modulator or transducer in various transmembranes signaling systems
Fragment0
Sequence
MPALHIEDLPEKEKLKMEVEQLRKEVKLQRQQVSKCSEEIKNYIEERSGEDPLVKGIPED
KNPFKEKGSCVIS
Effectors:
Effectors
NoNameRegulationPubMed
1Adenylate cyclase 2-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
2Raf1 protein kinase-Homo sapiensSequestration of G15251227
3Ras specific nucleotide exchange factor CDC25-Homo sapiensStimulation (indirect activation of ras)15251227 | 8717044
4Tubulin-Homo sapiens-1Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
5Tubulin-Homo sapiens-17Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
6Adenylate cyclase 7-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
7Brutons tyrosine kinase-Homo sapiensStimulation15251227 | 11698416
8Tubulin-Homo sapiens-6Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
9Rac-Homo sapiens-1"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
10ATP-sensitive inward rectifier potassium channel 10-Homo sapiensStimulation15251227 | 10990455
11ATP-sensitive inward rectifier potassium channel 12-Homo sapiensStimulation15251227 | 10990455
12Rho-Homo sapiens-3Recruitment to plasma membrane15251227
13Protein kinase D-Homo sapiensStimulation15251227
14Voltage dependent P/Q type calcium channel-Homo sapiensInhibition15251227 | 11031246
15Cdc42-Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
16Tubulin-Homo sapiens-2Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
17Adenylate cyclase 4-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
18Tubulin-Homo sapiens-18Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
19Tubulin-Homo sapiens-27Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
20ATP-sensitive inward rectifier potassium channel 8-Homo sapiensStimulation15251227 | 10990455
21Voltage dependent N type calcium channel-Homo sapiensInhibition15251227 | 11031246
22Voltage dependent R type calcium channel-Homo sapiensInhibition15251227 | 11031246
23Tubulin-Homo sapiens-26Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
24Phospholipase C beta 2-Homo sapiensStimulation15251227 | 11015615 | 8383116
25PI3K alpha-Homo sapiensPropable Inhibition16182515
26Tubulin-Homo sapiens-21Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
27PI3K gamma-Homo sapiensActivation12502714
28PI3K beta-Homo sapiensActivation9305878 | 12502714
29Tubulin-Homo sapiens-9Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
30ATP-sensitive inward rectifier potassium channel 11-Homo sapiensStimulation15251227 | 10990455
31Tubulin-Homo sapiens-14Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
32Tubulin-Homo sapiens-10Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
33Phospholipase C beta 3-Homo sapiensStimulation15251227 | 11015615 | 8383116
34GRK3-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
35ATP-sensitive inward rectifier potassium channel 15-Homo sapiensStimulation15251227 | 10990455
36Tubulin-Homo sapiens-11Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
37Tubulin-Homo sapiens-20Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
38Rac-Homo sapiens-3"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
39Adenylate cyclase 5-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
40Tubulin-Homo sapiens-12Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
41Tubulin-Homo sapiens-22Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
42SHC transforming protein 1-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
43Tubulin-Homo sapiens-25Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
44Tsk tyrosine kinase-Homo sapiensStimulation15251227 | 14671004
45Tubulin-Homo sapiens-3Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
46Tubulin-Homo sapiens-24Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
47Tubulin-Homo sapiens-8Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
48Tubulin-Homo sapiens-13Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
49GRK2-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
50SHC transforming protein 2-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
51ATP-sensitive inward rectifier potassium channel 14-Homo sapiensStimulation15251227 | 10990455
52ATP-sensitive inward rectifier potassium channel 1-Homo sapiensStimulation15251227 | 10990455
53SHC transforming protein 3-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
54Adenylate cyclase 6-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
55Tubulin-Homo sapiens-16Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
56Tubulin-Homo sapiens-19Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
57Tubulin-Homo sapiens-5Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
58Tubulin-Homo sapiens-7Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
59Kinase suppressor of Ras(KSR)-Homo sapiensSequestration of Gbeta/gamma15251227
60Tubulin-Homo sapiens-15Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
61Rho-Homo sapiens-1Recruitment to plasma membrane15251227
62Rac-Homo sapiens-2"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
63Rho-Homo sapiens-2Recruitment to plasma membrane15251227
64Calmodulin-Homo sapiensInhibition of calmodulin kinase15251227
65Tubulin-Homo sapiens-4Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
66Tubulin-Homo sapiens-23Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
67Adenylate cyclase 1-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933 | 10449730
68Phospholipase C beta 1-Homo sapiensStimulation15251227 | 11015615 | 8383116
69Dynamin 1-Homo sapiensIncreased GTPase activity15251227 | 14671004
Interacton with GPCRs:
Coupling with GPCRs
NoNameCouplingPubMed