Quick search:







Description Entry page for G-protein - 'Ggamma-11_Homo sapiens'
ClassGgamma
FamilyGgamma
Sub-FamilyGgamma
TypeGgamma-11
Cross References:
References
UniProtP61952 | P50152
EMBLU31384 | AF493878 | AC002076 | BC009709
InterProIPR015898 | IPR001770
PRODOMPD003783
GENEID2791
MIM604390
PRINTSPR00321
PFAMPF00631
Details:
Details
NameGgamma-11_Homo sapiens
DescriptionRecName: Full=Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11;Flags: Precursor
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGNG11 | GNGT1
FunctionGuanine nucleotide-binding proteins (G proteins) ares involved as a modulator or transducer in various transmembranes signaling systems
Fragment0
Sequence
MPALHIEDLPEKEKLKMEVEQLRKEVKLQRQQVSKCSEEIKNYIEERSGEDPLVKGIPED
KNPFKEKGSCVIS
Effectors:
Effectors
NoNameRegulationPubMed
1Tubulin-Homo sapiens-17Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
2Rho-Homo sapiens-3Recruitment to plasma membrane15251227
3Cdc42-Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
4Tubulin-Homo sapiens-12Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
5Tubulin-Homo sapiens-20Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
6ATP-sensitive inward rectifier potassium channel 14-Homo sapiensStimulation15251227 | 10990455
7ATP-sensitive inward rectifier potassium channel 12-Homo sapiensStimulation15251227 | 10990455
8Tubulin-Homo sapiens-2Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
9Adenylate cyclase 2-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
10Adenylate cyclase 4-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
11Phospholipase C beta 2-Homo sapiensStimulation15251227 | 11015615 | 8383116
12Adenylate cyclase 7-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
13Tubulin-Homo sapiens-9Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
14Tubulin-Homo sapiens-3Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
15Ras specific nucleotide exchange factor CDC25-Homo sapiensStimulation (indirect activation of ras)15251227 | 8717044
16Tubulin-Homo sapiens-18Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
17Adenylate cyclase 6-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
18Tubulin-Homo sapiens-1Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
19Tubulin-Homo sapiens-14Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
20Tubulin-Homo sapiens-16Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
21Brutons tyrosine kinase-Homo sapiensStimulation15251227 | 11698416
22Adenylate cyclase 1-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933 | 10449730
23Rho-Homo sapiens-2Recruitment to plasma membrane15251227
24Tubulin-Homo sapiens-27Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
25Tubulin-Homo sapiens-11Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
26Tubulin-Homo sapiens-24Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
27Voltage dependent N type calcium channel-Homo sapiensInhibition15251227 | 11031246
28Adenylate cyclase 5-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
29ATP-sensitive inward rectifier potassium channel 11-Homo sapiensStimulation15251227 | 10990455
30PI3K alpha-Homo sapiensPropable Inhibition16182515
31Rho-Homo sapiens-1Recruitment to plasma membrane15251227
32Rac-Homo sapiens-1"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
33Phospholipase C beta 1-Homo sapiensStimulation15251227 | 11015615 | 8383116
34Voltage dependent P/Q type calcium channel-Homo sapiensInhibition15251227 | 11031246
35Tsk tyrosine kinase-Homo sapiensStimulation15251227 | 14671004
36Tubulin-Homo sapiens-6Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
37Tubulin-Homo sapiens-23Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
38Tubulin-Homo sapiens-13Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
39Kinase suppressor of Ras(KSR)-Homo sapiensSequestration of Gbeta/gamma15251227
40PI3K gamma-Homo sapiensActivation12502714
41SHC transforming protein 1-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
42Voltage dependent R type calcium channel-Homo sapiensInhibition15251227 | 11031246
43Protein kinase D-Homo sapiensStimulation15251227
44Tubulin-Homo sapiens-21Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
45PI3K beta-Homo sapiensActivation9305878 | 12502714
46Calmodulin-Homo sapiensInhibition of calmodulin kinase15251227
47SHC transforming protein 3-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
48Rac-Homo sapiens-3"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
49SHC transforming protein 2-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
50GRK3-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
51Dynamin 1-Homo sapiensIncreased GTPase activity15251227 | 14671004
52Tubulin-Homo sapiens-7Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
53Tubulin-Homo sapiens-25Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
54Tubulin-Homo sapiens-8Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
55Tubulin-Homo sapiens-4Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
56Tubulin-Homo sapiens-22Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
57Tubulin-Homo sapiens-26Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
58Tubulin-Homo sapiens-19Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
59Tubulin-Homo sapiens-5Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
60ATP-sensitive inward rectifier potassium channel 8-Homo sapiensStimulation15251227 | 10990455
61Rac-Homo sapiens-2"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
62Tubulin-Homo sapiens-10Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
63ATP-sensitive inward rectifier potassium channel 1-Homo sapiensStimulation15251227 | 10990455
64ATP-sensitive inward rectifier potassium channel 15-Homo sapiensStimulation15251227 | 10990455
65Raf1 protein kinase-Homo sapiensSequestration of G15251227
66Phospholipase C beta 3-Homo sapiensStimulation15251227 | 11015615 | 8383116
67GRK2-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
68ATP-sensitive inward rectifier potassium channel 10-Homo sapiensStimulation15251227 | 10990455
69Tubulin-Homo sapiens-15Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
Interacton with GPCRs:
Coupling with GPCRs
NoNameCouplingPubMed