Quick search:







Description Entry page for G-protein - 'Ggamma-11_Homo sapiens'
ClassGgamma
FamilyGgamma
Sub-FamilyGgamma
TypeGgamma-11
Cross References:
References
UniProtP61952 | P50152
EMBLU31384 | AF493878 | AC002076 | BC009709
InterProIPR015898 | IPR001770
PRODOMPD003783
GENEID2791
MIM604390
PRINTSPR00321
PFAMPF00631
Details:
Details
NameGgamma-11_Homo sapiens
DescriptionRecName: Full=Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11;Flags: Precursor
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGNG11 | GNGT1
FunctionGuanine nucleotide-binding proteins (G proteins) ares involved as a modulator or transducer in various transmembranes signaling systems
Fragment0
Sequence
MPALHIEDLPEKEKLKMEVEQLRKEVKLQRQQVSKCSEEIKNYIEERSGEDPLVKGIPED
KNPFKEKGSCVIS
Effectors:
Effectors
NoNameRegulationPubMed
1Tubulin-Homo sapiens-14Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
2ATP-sensitive inward rectifier potassium channel 11-Homo sapiensStimulation15251227 | 10990455
3Tubulin-Homo sapiens-4Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
4Tubulin-Homo sapiens-17Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
5ATP-sensitive inward rectifier potassium channel 1-Homo sapiensStimulation15251227 | 10990455
6Adenylate cyclase 5-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
7Rho-Homo sapiens-2Recruitment to plasma membrane15251227
8SHC transforming protein 2-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
9Tsk tyrosine kinase-Homo sapiensStimulation15251227 | 14671004
10Tubulin-Homo sapiens-23Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
11Tubulin-Homo sapiens-25Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
12Phospholipase C beta 1-Homo sapiensStimulation15251227 | 11015615 | 8383116
13Tubulin-Homo sapiens-9Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
14Rac-Homo sapiens-1"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
15ATP-sensitive inward rectifier potassium channel 15-Homo sapiensStimulation15251227 | 10990455
16Rac-Homo sapiens-2"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
17Dynamin 1-Homo sapiensIncreased GTPase activity15251227 | 14671004
18Brutons tyrosine kinase-Homo sapiensStimulation15251227 | 11698416
19Tubulin-Homo sapiens-12Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
20Rho-Homo sapiens-3Recruitment to plasma membrane15251227
21Tubulin-Homo sapiens-7Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
22Tubulin-Homo sapiens-26Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
23ATP-sensitive inward rectifier potassium channel 8-Homo sapiensStimulation15251227 | 10990455
24Phospholipase C beta 2-Homo sapiensStimulation15251227 | 11015615 | 8383116
25Rac-Homo sapiens-3"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
26Tubulin-Homo sapiens-24Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
27Adenylate cyclase 1-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933 | 10449730
28Adenylate cyclase 7-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
29Tubulin-Homo sapiens-8Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
30Tubulin-Homo sapiens-3Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
31Voltage dependent P/Q type calcium channel-Homo sapiensInhibition15251227 | 11031246
32SHC transforming protein 3-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
33Raf1 protein kinase-Homo sapiensSequestration of G15251227
34Tubulin-Homo sapiens-15Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
35GRK2-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
36Tubulin-Homo sapiens-2Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
37Tubulin-Homo sapiens-6Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
38Tubulin-Homo sapiens-21Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
39Tubulin-Homo sapiens-13Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
40ATP-sensitive inward rectifier potassium channel 14-Homo sapiensStimulation15251227 | 10990455
41Adenylate cyclase 4-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
42Tubulin-Homo sapiens-27Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
43Calmodulin-Homo sapiensInhibition of calmodulin kinase15251227
44Adenylate cyclase 2-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
45Tubulin-Homo sapiens-22Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
46Tubulin-Homo sapiens-5Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
47Phospholipase C beta 3-Homo sapiensStimulation15251227 | 11015615 | 8383116
48Protein kinase D-Homo sapiensStimulation15251227
49Adenylate cyclase 6-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
50Tubulin-Homo sapiens-1Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
51Kinase suppressor of Ras(KSR)-Homo sapiensSequestration of Gbeta/gamma15251227
52Cdc42-Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
53SHC transforming protein 1-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
54PI3K alpha-Homo sapiensPropable Inhibition16182515
55Rho-Homo sapiens-1Recruitment to plasma membrane15251227
56Tubulin-Homo sapiens-20Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
57Tubulin-Homo sapiens-11Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
58Tubulin-Homo sapiens-19Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
59Ras specific nucleotide exchange factor CDC25-Homo sapiensStimulation (indirect activation of ras)15251227 | 8717044
60ATP-sensitive inward rectifier potassium channel 10-Homo sapiensStimulation15251227 | 10990455
61PI3K beta-Homo sapiensActivation9305878 | 12502714
62Voltage dependent R type calcium channel-Homo sapiensInhibition15251227 | 11031246
63PI3K gamma-Homo sapiensActivation12502714
64Tubulin-Homo sapiens-18Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
65Tubulin-Homo sapiens-16Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
66Tubulin-Homo sapiens-10Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
67Voltage dependent N type calcium channel-Homo sapiensInhibition15251227 | 11031246
68ATP-sensitive inward rectifier potassium channel 12-Homo sapiensStimulation15251227 | 10990455
69GRK3-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
Interacton with GPCRs:
Coupling with GPCRs
NoNameCouplingPubMed