Quick search:







Description Entry page for G-protein - 'Ggamma-12_Homo sapiens'
ClassGgamma
FamilyGgamma
Sub-FamilyGgamma
TypeGgamma-12
Cross References:
References
UniProtQ9UBI6 | Q9BRV5
EMBLAF188181 | AF119663 | AF365871 | AF493879 | BC005940
InterProIPR015898 | IPR001770
PRODOMPD003783
GENEID55970
MIM
PRINTSPR00321
PFAMPF00631
Details:
Details
NameGgamma-12_Homo sapiens
DescriptionRecName: Full=Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12;Flags: Precursor
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGNG1
FunctionGuanine nucleotide-binding proteins (G proteins) ares involved as a modulator or transducer in various transmembranes signaling systems
Fragment0
Sequence
MSSKTASTNNIAQARRTVQQLRLEASIERIKVSKASADLMSYCEEHARSDPLLIGIPTSE
NPFKDKKTCIIL
Effectors:
Effectors
NoNameRegulationPubMed
1ATP-sensitive inward rectifier potassium channel 14-Homo sapiensStimulation15251227 | 10990455
2Phospholipase C beta 1-Homo sapiensStimulation15251227 | 11015615 | 8383116
3SHC transforming protein 1-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
4Tubulin-Homo sapiens-6Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
5GRK2-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
6ATP-sensitive inward rectifier potassium channel 12-Homo sapiensStimulation15251227 | 10990455
7Protein kinase D-Homo sapiensStimulation15251227
8PI3K alpha-Homo sapiensPropable Inhibition16182515
9Tubulin-Homo sapiens-12Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
10Adenylate cyclase 2-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
11Phospholipase C beta 2-Homo sapiensStimulation15251227 | 11015615 | 8383116
12Tubulin-Homo sapiens-2Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
13Tsk tyrosine kinase-Homo sapiensStimulation15251227 | 14671004
14Tubulin-Homo sapiens-27Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
15Tubulin-Homo sapiens-20Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
16Tubulin-Homo sapiens-18Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
17Voltage dependent N type calcium channel-Homo sapiensInhibition15251227 | 11031246
18Ras specific nucleotide exchange factor CDC25-Homo sapiensStimulation (indirect activation of ras)15251227 | 8717044
19Voltage dependent P/Q type calcium channel-Homo sapiensInhibition15251227 | 11031246
20Tubulin-Homo sapiens-4Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
21Tubulin-Homo sapiens-1Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
22SHC transforming protein 2-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
23Tubulin-Homo sapiens-9Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
24Rac-Homo sapiens-1"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
25Tubulin-Homo sapiens-26Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
26ATP-sensitive inward rectifier potassium channel 1-Homo sapiensStimulation15251227 | 10990455
27Cdc42-Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
28Kinase suppressor of Ras(KSR)-Homo sapiensSequestration of Gbeta/gamma15251227
29Adenylate cyclase 5-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
30Tubulin-Homo sapiens-10Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
31Voltage dependent R type calcium channel-Homo sapiensInhibition15251227 | 11031246
32SHC transforming protein 3-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
33Adenylate cyclase 4-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
34Rac-Homo sapiens-3"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
35PI3K gamma-Homo sapiensActivation12502714
36Tubulin-Homo sapiens-23Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
37Tubulin-Homo sapiens-24Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
38GRK3-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
39Rac-Homo sapiens-2"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
40Phospholipase C beta 3-Homo sapiensStimulation15251227 | 11015615 | 8383116
41Tubulin-Homo sapiens-13Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
42Adenylate cyclase 1-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933 | 10449730
43Rho-Homo sapiens-3Recruitment to plasma membrane15251227
44Rho-Homo sapiens-2Recruitment to plasma membrane15251227
45Raf1 protein kinase-Homo sapiensSequestration of G15251227
46ATP-sensitive inward rectifier potassium channel 8-Homo sapiensStimulation15251227 | 10990455
47Tubulin-Homo sapiens-14Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
48Tubulin-Homo sapiens-19Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
49Dynamin 1-Homo sapiensIncreased GTPase activity15251227 | 14671004
50ATP-sensitive inward rectifier potassium channel 10-Homo sapiensStimulation15251227 | 10990455
51Tubulin-Homo sapiens-16Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
52Tubulin-Homo sapiens-15Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
53Tubulin-Homo sapiens-22Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
54Adenylate cyclase 6-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
55Adenylate cyclase 7-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
56ATP-sensitive inward rectifier potassium channel 15-Homo sapiensStimulation15251227 | 10990455
57PI3K beta-Homo sapiensActivation9305878 | 12502714
58ATP-sensitive inward rectifier potassium channel 11-Homo sapiensStimulation15251227 | 10990455
59Tubulin-Homo sapiens-5Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
60Brutons tyrosine kinase-Homo sapiensStimulation15251227 | 11698416
61Tubulin-Homo sapiens-21Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
62Calmodulin-Homo sapiensInhibition of calmodulin kinase15251227
63Rho-Homo sapiens-1Recruitment to plasma membrane15251227
64Tubulin-Homo sapiens-3Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
65Tubulin-Homo sapiens-8Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
66Tubulin-Homo sapiens-25Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
67Tubulin-Homo sapiens-11Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
68Tubulin-Homo sapiens-17Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
69Tubulin-Homo sapiens-7Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
Interacton with GPCRs:
Coupling with GPCRs
NoNameCouplingPubMed