Quick search:







Description Entry page for G-protein - 'Ggamma-12_Homo sapiens'
ClassGgamma
FamilyGgamma
Sub-FamilyGgamma
TypeGgamma-12
Cross References:
References
UniProtQ9UBI6 | Q9BRV5
EMBLAF188181 | AF119663 | AF365871 | AF493879 | BC005940
InterProIPR015898 | IPR001770
PRODOMPD003783
GENEID55970
MIM
PRINTSPR00321
PFAMPF00631
Details:
Details
NameGgamma-12_Homo sapiens
DescriptionRecName: Full=Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12;Flags: Precursor
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGNG1
FunctionGuanine nucleotide-binding proteins (G proteins) ares involved as a modulator or transducer in various transmembranes signaling systems
Fragment0
Sequence
MSSKTASTNNIAQARRTVQQLRLEASIERIKVSKASADLMSYCEEHARSDPLLIGIPTSE
NPFKDKKTCIIL
Effectors:
Effectors
NoNameRegulationPubMed
1Tubulin-Homo sapiens-27Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
2Tubulin-Homo sapiens-9Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
3Tubulin-Homo sapiens-13Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
4Rac-Homo sapiens-1"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
5Tubulin-Homo sapiens-7Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
6Voltage dependent R type calcium channel-Homo sapiensInhibition15251227 | 11031246
7Phospholipase C beta 1-Homo sapiensStimulation15251227 | 11015615 | 8383116
8Phospholipase C beta 3-Homo sapiensStimulation15251227 | 11015615 | 8383116
9Tubulin-Homo sapiens-22Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
10GRK3-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
11Tubulin-Homo sapiens-14Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
12ATP-sensitive inward rectifier potassium channel 11-Homo sapiensStimulation15251227 | 10990455
13Brutons tyrosine kinase-Homo sapiensStimulation15251227 | 11698416
14Tubulin-Homo sapiens-21Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
15Tubulin-Homo sapiens-10Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
16Tubulin-Homo sapiens-24Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
17Voltage dependent N type calcium channel-Homo sapiensInhibition15251227 | 11031246
18Tubulin-Homo sapiens-23Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
19Tubulin-Homo sapiens-16Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
20GRK2-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
21ATP-sensitive inward rectifier potassium channel 14-Homo sapiensStimulation15251227 | 10990455
22Adenylate cyclase 5-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
23Adenylate cyclase 1-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933 | 10449730
24Adenylate cyclase 2-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
25Tubulin-Homo sapiens-2Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
26Tubulin-Homo sapiens-8Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
27Calmodulin-Homo sapiensInhibition of calmodulin kinase15251227
28Tubulin-Homo sapiens-20Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
29ATP-sensitive inward rectifier potassium channel 1-Homo sapiensStimulation15251227 | 10990455
30SHC transforming protein 3-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
31Voltage dependent P/Q type calcium channel-Homo sapiensInhibition15251227 | 11031246
32Tsk tyrosine kinase-Homo sapiensStimulation15251227 | 14671004
33Phospholipase C beta 2-Homo sapiensStimulation15251227 | 11015615 | 8383116
34Tubulin-Homo sapiens-11Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
35Tubulin-Homo sapiens-1Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
36Tubulin-Homo sapiens-3Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
37Cdc42-Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
38Rho-Homo sapiens-1Recruitment to plasma membrane15251227
39Protein kinase D-Homo sapiensStimulation15251227
40Adenylate cyclase 7-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
41Tubulin-Homo sapiens-4Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
42Dynamin 1-Homo sapiensIncreased GTPase activity15251227 | 14671004
43PI3K alpha-Homo sapiensPropable Inhibition16182515
44Tubulin-Homo sapiens-19Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
45Rac-Homo sapiens-2"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
46SHC transforming protein 1-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
47PI3K gamma-Homo sapiensActivation12502714
48Tubulin-Homo sapiens-26Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
49Tubulin-Homo sapiens-17Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
50Tubulin-Homo sapiens-15Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
51Tubulin-Homo sapiens-5Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
52Rac-Homo sapiens-3"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
53Tubulin-Homo sapiens-25Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
54Kinase suppressor of Ras(KSR)-Homo sapiensSequestration of Gbeta/gamma15251227
55ATP-sensitive inward rectifier potassium channel 12-Homo sapiensStimulation15251227 | 10990455
56Rho-Homo sapiens-3Recruitment to plasma membrane15251227
57Tubulin-Homo sapiens-12Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
58ATP-sensitive inward rectifier potassium channel 8-Homo sapiensStimulation15251227 | 10990455
59Rho-Homo sapiens-2Recruitment to plasma membrane15251227
60Adenylate cyclase 6-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
61ATP-sensitive inward rectifier potassium channel 10-Homo sapiensStimulation15251227 | 10990455
62Tubulin-Homo sapiens-6Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
63PI3K beta-Homo sapiensActivation9305878 | 12502714
64Ras specific nucleotide exchange factor CDC25-Homo sapiensStimulation (indirect activation of ras)15251227 | 8717044
65ATP-sensitive inward rectifier potassium channel 15-Homo sapiensStimulation15251227 | 10990455
66SHC transforming protein 2-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
67Tubulin-Homo sapiens-18Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
68Raf1 protein kinase-Homo sapiensSequestration of G15251227
69Adenylate cyclase 4-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
Interacton with GPCRs:
Coupling with GPCRs
NoNameCouplingPubMed