Quick search:







Description Entry page for G-protein - 'Ggamma-12_Homo sapiens'
ClassGgamma
FamilyGgamma
Sub-FamilyGgamma
TypeGgamma-12
Cross References:
References
UniProtQ9UBI6 | Q9BRV5
EMBLAF188181 | AF119663 | AF365871 | AF493879 | BC005940
InterProIPR015898 | IPR001770
PRODOMPD003783
GENEID55970
MIM
PRINTSPR00321
PFAMPF00631
Details:
Details
NameGgamma-12_Homo sapiens
DescriptionRecName: Full=Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12;Flags: Precursor
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGNG1
FunctionGuanine nucleotide-binding proteins (G proteins) ares involved as a modulator or transducer in various transmembranes signaling systems
Fragment0
Sequence
MSSKTASTNNIAQARRTVQQLRLEASIERIKVSKASADLMSYCEEHARSDPLLIGIPTSE
NPFKDKKTCIIL
Effectors:
Effectors
NoNameRegulationPubMed
1Rho-Homo sapiens-1Recruitment to plasma membrane15251227
2Tubulin-Homo sapiens-5Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
3Tubulin-Homo sapiens-1Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
4Tubulin-Homo sapiens-19Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
5Tubulin-Homo sapiens-24Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
6PI3K alpha-Homo sapiensPropable Inhibition16182515
7Tubulin-Homo sapiens-6Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
8Voltage dependent P/Q type calcium channel-Homo sapiensInhibition15251227 | 11031246
9PI3K beta-Homo sapiensActivation9305878 | 12502714
10Raf1 protein kinase-Homo sapiensSequestration of G15251227
11ATP-sensitive inward rectifier potassium channel 8-Homo sapiensStimulation15251227 | 10990455
12Tubulin-Homo sapiens-21Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
13Tubulin-Homo sapiens-15Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
14Phospholipase C beta 1-Homo sapiensStimulation15251227 | 11015615 | 8383116
15SHC transforming protein 3-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
16Phospholipase C beta 3-Homo sapiensStimulation15251227 | 11015615 | 8383116
17Tubulin-Homo sapiens-11Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
18Tubulin-Homo sapiens-10Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
19Tubulin-Homo sapiens-2Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
20Tubulin-Homo sapiens-16Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
21GRK2-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
22Voltage dependent N type calcium channel-Homo sapiensInhibition15251227 | 11031246
23Kinase suppressor of Ras(KSR)-Homo sapiensSequestration of Gbeta/gamma15251227
24Tubulin-Homo sapiens-23Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
25Tubulin-Homo sapiens-22Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
26PI3K gamma-Homo sapiensActivation12502714
27Tubulin-Homo sapiens-13Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
28Voltage dependent R type calcium channel-Homo sapiensInhibition15251227 | 11031246
29Brutons tyrosine kinase-Homo sapiensStimulation15251227 | 11698416
30Cdc42-Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
31Rac-Homo sapiens-2"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
32Rho-Homo sapiens-2Recruitment to plasma membrane15251227
33ATP-sensitive inward rectifier potassium channel 1-Homo sapiensStimulation15251227 | 10990455
34Tubulin-Homo sapiens-9Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
35Adenylate cyclase 2-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
36Tubulin-Homo sapiens-18Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
37Tubulin-Homo sapiens-25Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
38ATP-sensitive inward rectifier potassium channel 12-Homo sapiensStimulation15251227 | 10990455
39Tubulin-Homo sapiens-14Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
40Rho-Homo sapiens-3Recruitment to plasma membrane15251227
41Tubulin-Homo sapiens-4Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
42Rac-Homo sapiens-1"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
43Tubulin-Homo sapiens-7Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
44Tubulin-Homo sapiens-3Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
45Calmodulin-Homo sapiensInhibition of calmodulin kinase15251227
46ATP-sensitive inward rectifier potassium channel 10-Homo sapiensStimulation15251227 | 10990455
47ATP-sensitive inward rectifier potassium channel 14-Homo sapiensStimulation15251227 | 10990455
48Adenylate cyclase 1-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933 | 10449730
49Tubulin-Homo sapiens-17Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
50GRK3-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
51ATP-sensitive inward rectifier potassium channel 15-Homo sapiensStimulation15251227 | 10990455
52Dynamin 1-Homo sapiensIncreased GTPase activity15251227 | 14671004
53Tubulin-Homo sapiens-12Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
54Phospholipase C beta 2-Homo sapiensStimulation15251227 | 11015615 | 8383116
55Tsk tyrosine kinase-Homo sapiensStimulation15251227 | 14671004
56Protein kinase D-Homo sapiensStimulation15251227
57Tubulin-Homo sapiens-8Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
58Tubulin-Homo sapiens-26Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
59Tubulin-Homo sapiens-27Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
60SHC transforming protein 1-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
61Adenylate cyclase 5-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
62Adenylate cyclase 7-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
63SHC transforming protein 2-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
64Tubulin-Homo sapiens-20Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
65Ras specific nucleotide exchange factor CDC25-Homo sapiensStimulation (indirect activation of ras)15251227 | 8717044
66ATP-sensitive inward rectifier potassium channel 11-Homo sapiensStimulation15251227 | 10990455
67Adenylate cyclase 4-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
68Rac-Homo sapiens-3"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
69Adenylate cyclase 6-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
Interacton with GPCRs:
Coupling with GPCRs
NoNameCouplingPubMed