Quick search:







Description Entry page for G-protein - 'Ggamma-12_Homo sapiens'
ClassGgamma
FamilyGgamma
Sub-FamilyGgamma
TypeGgamma-12
Cross References:
References
UniProtQ9UBI6 | Q9BRV5
EMBLAF188181 | AF119663 | AF365871 | AF493879 | BC005940
InterProIPR015898 | IPR001770
PRODOMPD003783
GENEID55970
MIM
PRINTSPR00321
PFAMPF00631
Details:
Details
NameGgamma-12_Homo sapiens
DescriptionRecName: Full=Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12;Flags: Precursor
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGNG1
FunctionGuanine nucleotide-binding proteins (G proteins) ares involved as a modulator or transducer in various transmembranes signaling systems
Fragment0
Sequence
MSSKTASTNNIAQARRTVQQLRLEASIERIKVSKASADLMSYCEEHARSDPLLIGIPTSE
NPFKDKKTCIIL
Effectors:
Effectors
NoNameRegulationPubMed
1Tubulin-Homo sapiens-23Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
2Tubulin-Homo sapiens-17Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
3Adenylate cyclase 2-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
4Tubulin-Homo sapiens-27Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
5Tubulin-Homo sapiens-16Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
6Adenylate cyclase 7-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
7Voltage dependent P/Q type calcium channel-Homo sapiensInhibition15251227 | 11031246
8Ras specific nucleotide exchange factor CDC25-Homo sapiensStimulation (indirect activation of ras)15251227 | 8717044
9PI3K beta-Homo sapiensActivation9305878 | 12502714
10ATP-sensitive inward rectifier potassium channel 15-Homo sapiensStimulation15251227 | 10990455
11PI3K alpha-Homo sapiensPropable Inhibition16182515
12SHC transforming protein 2-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
13Voltage dependent N type calcium channel-Homo sapiensInhibition15251227 | 11031246
14Adenylate cyclase 5-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
15Tubulin-Homo sapiens-8Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
16Tubulin-Homo sapiens-21Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
17Tubulin-Homo sapiens-19Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
18Calmodulin-Homo sapiensInhibition of calmodulin kinase15251227
19Protein kinase D-Homo sapiensStimulation15251227
20Tubulin-Homo sapiens-2Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
21GRK3-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
22Cdc42-Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
23Tubulin-Homo sapiens-24Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
24Rac-Homo sapiens-2"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
25Tubulin-Homo sapiens-22Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
26Tubulin-Homo sapiens-26Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
27ATP-sensitive inward rectifier potassium channel 11-Homo sapiensStimulation15251227 | 10990455
28Rho-Homo sapiens-3Recruitment to plasma membrane15251227
29Voltage dependent R type calcium channel-Homo sapiensInhibition15251227 | 11031246
30PI3K gamma-Homo sapiensActivation12502714
31Tubulin-Homo sapiens-15Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
32Tubulin-Homo sapiens-9Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
33Adenylate cyclase 4-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
34Rho-Homo sapiens-2Recruitment to plasma membrane15251227
35Rac-Homo sapiens-3"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
36GRK2-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
37Kinase suppressor of Ras(KSR)-Homo sapiensSequestration of Gbeta/gamma15251227
38Tubulin-Homo sapiens-4Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
39ATP-sensitive inward rectifier potassium channel 12-Homo sapiensStimulation15251227 | 10990455
40Tubulin-Homo sapiens-10Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
41Tubulin-Homo sapiens-20Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
42SHC transforming protein 3-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
43Brutons tyrosine kinase-Homo sapiensStimulation15251227 | 11698416
44Rac-Homo sapiens-1"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
45Tubulin-Homo sapiens-11Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
46ATP-sensitive inward rectifier potassium channel 1-Homo sapiensStimulation15251227 | 10990455
47ATP-sensitive inward rectifier potassium channel 14-Homo sapiensStimulation15251227 | 10990455
48Tubulin-Homo sapiens-1Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
49Phospholipase C beta 1-Homo sapiensStimulation15251227 | 11015615 | 8383116
50Phospholipase C beta 2-Homo sapiensStimulation15251227 | 11015615 | 8383116
51Adenylate cyclase 1-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933 | 10449730
52Rho-Homo sapiens-1Recruitment to plasma membrane15251227
53Tubulin-Homo sapiens-3Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
54Tubulin-Homo sapiens-14Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
55Tubulin-Homo sapiens-13Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
56Tubulin-Homo sapiens-12Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
57SHC transforming protein 1-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
58Tsk tyrosine kinase-Homo sapiensStimulation15251227 | 14671004
59Adenylate cyclase 6-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
60Tubulin-Homo sapiens-25Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
61Tubulin-Homo sapiens-18Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
62ATP-sensitive inward rectifier potassium channel 8-Homo sapiensStimulation15251227 | 10990455
63Phospholipase C beta 3-Homo sapiensStimulation15251227 | 11015615 | 8383116
64Dynamin 1-Homo sapiensIncreased GTPase activity15251227 | 14671004
65Tubulin-Homo sapiens-5Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
66Tubulin-Homo sapiens-7Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
67Tubulin-Homo sapiens-6Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
68Raf1 protein kinase-Homo sapiensSequestration of G15251227
69ATP-sensitive inward rectifier potassium channel 10-Homo sapiensStimulation15251227 | 10990455
Interacton with GPCRs:
Coupling with GPCRs
NoNameCouplingPubMed