Quick search:







Description Entry page for G-protein - 'Ggamma-13_Homo sapiens'
ClassGgamma
FamilyGgamma
Sub-FamilyGgamma
TypeGgamma-13
Cross References:
References
UniProtQ9P2W3 | B2R5C8 | Q52LX0 | Q9UJJ3
EMBLAY029486 | AB030207 | AF493880 | AK312139 | AE006465 | AL031033 | BC093760 | BC095525
InterProIPR015898 | IPR001770
PRODOMPD003783
GENEID51764
MIM607298
PRINTSPR00321
PFAMPF00631
Details:
Details
NameGgamma-13_Homo sapiens
DescriptionRecName: Full=Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13;Flags: Precursor
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGNG1
FunctionGuanine nucleotide-binding proteins (G proteins) ares involved as a modulator or transducer in various transmembranes signaling systems
Fragment0
Sequence
MEEWDVPQMKKEVESLKYQLAFQREMASKTIPELLKWIEDGIPKDPFLNPDLMKNNPWVE
KGKCTIL
Effectors:
Effectors
NoNameRegulationPubMed
1Tubulin-Homo sapiens-4Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
2Voltage dependent P/Q type calcium channel-Homo sapiensInhibition15251227 | 11031246
3Tubulin-Homo sapiens-25Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
4Rho-Homo sapiens-3Recruitment to plasma membrane15251227
5Tubulin-Homo sapiens-2Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
6SHC transforming protein 2-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
7Rac-Homo sapiens-3"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
8ATP-sensitive inward rectifier potassium channel 1-Homo sapiensStimulation15251227 | 10990455
9ATP-sensitive inward rectifier potassium channel 14-Homo sapiensStimulation15251227 | 10990455
10ATP-sensitive inward rectifier potassium channel 10-Homo sapiensStimulation15251227 | 10990455
11Tubulin-Homo sapiens-24Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
12Cdc42-Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
13Phospholipase C beta 3-Homo sapiensStimulation15251227 | 11015615 | 8383116
14Brutons tyrosine kinase-Homo sapiensStimulation15251227 | 11698416
15Phospholipase C beta 2-Homo sapiensStimulation15251227 | 11015615 | 8383116
16Voltage dependent N type calcium channel-Homo sapiensInhibition15251227 | 11031246
17Tubulin-Homo sapiens-6Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
18Rac-Homo sapiens-1"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
19SHC transforming protein 3-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
20Tubulin-Homo sapiens-3Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
21GRK3-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
22Voltage dependent R type calcium channel-Homo sapiensInhibition15251227 | 11031246
23Adenylate cyclase 5-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
24Tubulin-Homo sapiens-15Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
25Tubulin-Homo sapiens-23Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
26Rho-Homo sapiens-1Recruitment to plasma membrane15251227
27PI3K alpha-Homo sapiensPropable Inhibition16182515
28Tubulin-Homo sapiens-1Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
29Tsk tyrosine kinase-Homo sapiensStimulation15251227 | 14671004
30Tubulin-Homo sapiens-22Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
31Phospholipase C beta 1-Homo sapiensStimulation15251227 | 11015615 | 8383116
32Tubulin-Homo sapiens-19Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
33Tubulin-Homo sapiens-16Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
34ATP-sensitive inward rectifier potassium channel 15-Homo sapiensStimulation15251227 | 10990455
35Tubulin-Homo sapiens-7Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
36Adenylate cyclase 4-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
37Adenylate cyclase 2-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
38Calmodulin-Homo sapiensInhibition of calmodulin kinase15251227
39Dynamin 1-Homo sapiensIncreased GTPase activity15251227 | 14671004
40ATP-sensitive inward rectifier potassium channel 11-Homo sapiensStimulation15251227 | 10990455
41Tubulin-Homo sapiens-10Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
42PI3K gamma-Homo sapiensActivation12502714
43Adenylate cyclase 6-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
44Tubulin-Homo sapiens-13Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
45PI3K beta-Homo sapiensActivation9305878 | 12502714
46Raf1 protein kinase-Homo sapiensSequestration of G15251227
47Tubulin-Homo sapiens-5Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
48Rac-Homo sapiens-2"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
49Tubulin-Homo sapiens-18Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
50Tubulin-Homo sapiens-27Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
51Tubulin-Homo sapiens-12Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
52Tubulin-Homo sapiens-8Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
53Tubulin-Homo sapiens-9Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
54Tubulin-Homo sapiens-21Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
55Tubulin-Homo sapiens-26Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
56Tubulin-Homo sapiens-11Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
57Adenylate cyclase 7-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
58Tubulin-Homo sapiens-17Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
59SHC transforming protein 1-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
60GRK2-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
61Rho-Homo sapiens-2Recruitment to plasma membrane15251227
62Kinase suppressor of Ras(KSR)-Homo sapiensSequestration of Gbeta/gamma15251227
63Protein kinase D-Homo sapiensStimulation15251227
64Adenylate cyclase 1-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933 | 10449730
65ATP-sensitive inward rectifier potassium channel 8-Homo sapiensStimulation15251227 | 10990455
66Tubulin-Homo sapiens-14Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
67Tubulin-Homo sapiens-20Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
68ATP-sensitive inward rectifier potassium channel 12-Homo sapiensStimulation15251227 | 10990455
69Ras specific nucleotide exchange factor CDC25-Homo sapiensStimulation (indirect activation of ras)15251227 | 8717044
Interacton with GPCRs:
Coupling with GPCRs
NoNameCouplingPubMed