Quick search:







Description Entry page for G-protein - 'Ggamma-13_Homo sapiens'
ClassGgamma
FamilyGgamma
Sub-FamilyGgamma
TypeGgamma-13
Cross References:
References
UniProtQ9P2W3 | B2R5C8 | Q52LX0 | Q9UJJ3
EMBLAY029486 | AB030207 | AF493880 | AK312139 | AE006465 | AL031033 | BC093760 | BC095525
InterProIPR015898 | IPR001770
PRODOMPD003783
GENEID51764
MIM607298
PRINTSPR00321
PFAMPF00631
Details:
Details
NameGgamma-13_Homo sapiens
DescriptionRecName: Full=Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13;Flags: Precursor
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGNG1
FunctionGuanine nucleotide-binding proteins (G proteins) ares involved as a modulator or transducer in various transmembranes signaling systems
Fragment0
Sequence
MEEWDVPQMKKEVESLKYQLAFQREMASKTIPELLKWIEDGIPKDPFLNPDLMKNNPWVE
KGKCTIL
Effectors:
Effectors
NoNameRegulationPubMed
1Brutons tyrosine kinase-Homo sapiensStimulation15251227 | 11698416
2Tubulin-Homo sapiens-17Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
3Adenylate cyclase 4-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
4Voltage dependent N type calcium channel-Homo sapiensInhibition15251227 | 11031246
5Rac-Homo sapiens-2"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
6Cdc42-Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
7Voltage dependent P/Q type calcium channel-Homo sapiensInhibition15251227 | 11031246
8Rac-Homo sapiens-3"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
9Adenylate cyclase 2-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
10ATP-sensitive inward rectifier potassium channel 1-Homo sapiensStimulation15251227 | 10990455
11PI3K beta-Homo sapiensActivation9305878 | 12502714
12Raf1 protein kinase-Homo sapiensSequestration of G15251227
13Tubulin-Homo sapiens-21Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
14Tubulin-Homo sapiens-1Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
15Ras specific nucleotide exchange factor CDC25-Homo sapiensStimulation (indirect activation of ras)15251227 | 8717044
16Tubulin-Homo sapiens-24Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
17Tubulin-Homo sapiens-25Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
18Tubulin-Homo sapiens-4Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
19Phospholipase C beta 3-Homo sapiensStimulation15251227 | 11015615 | 8383116
20ATP-sensitive inward rectifier potassium channel 12-Homo sapiensStimulation15251227 | 10990455
21Tubulin-Homo sapiens-16Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
22Tubulin-Homo sapiens-6Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
23Rho-Homo sapiens-2Recruitment to plasma membrane15251227
24GRK2-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
25PI3K alpha-Homo sapiensPropable Inhibition16182515
26Tubulin-Homo sapiens-20Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
27Phospholipase C beta 2-Homo sapiensStimulation15251227 | 11015615 | 8383116
28Tubulin-Homo sapiens-27Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
29Tubulin-Homo sapiens-7Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
30Tubulin-Homo sapiens-12Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
31ATP-sensitive inward rectifier potassium channel 14-Homo sapiensStimulation15251227 | 10990455
32Adenylate cyclase 1-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933 | 10449730
33Tubulin-Homo sapiens-9Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
34Rho-Homo sapiens-1Recruitment to plasma membrane15251227
35Adenylate cyclase 6-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
36Tubulin-Homo sapiens-11Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
37Tubulin-Homo sapiens-15Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
38Tubulin-Homo sapiens-14Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
39Tsk tyrosine kinase-Homo sapiensStimulation15251227 | 14671004
40SHC transforming protein 1-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
41Tubulin-Homo sapiens-18Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
42Tubulin-Homo sapiens-8Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
43Kinase suppressor of Ras(KSR)-Homo sapiensSequestration of Gbeta/gamma15251227
44Tubulin-Homo sapiens-26Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
45Phospholipase C beta 1-Homo sapiensStimulation15251227 | 11015615 | 8383116
46Rho-Homo sapiens-3Recruitment to plasma membrane15251227
47ATP-sensitive inward rectifier potassium channel 10-Homo sapiensStimulation15251227 | 10990455
48Tubulin-Homo sapiens-22Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
49PI3K gamma-Homo sapiensActivation12502714
50Tubulin-Homo sapiens-10Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
51SHC transforming protein 3-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
52Adenylate cyclase 7-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
53Calmodulin-Homo sapiensInhibition of calmodulin kinase15251227
54ATP-sensitive inward rectifier potassium channel 11-Homo sapiensStimulation15251227 | 10990455
55Tubulin-Homo sapiens-19Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
56Rac-Homo sapiens-1"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
57Tubulin-Homo sapiens-5Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
58Dynamin 1-Homo sapiensIncreased GTPase activity15251227 | 14671004
59Voltage dependent R type calcium channel-Homo sapiensInhibition15251227 | 11031246
60Adenylate cyclase 5-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
61GRK3-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
62Tubulin-Homo sapiens-13Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
63Tubulin-Homo sapiens-23Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
64Tubulin-Homo sapiens-2Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
65Tubulin-Homo sapiens-3Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
66Protein kinase D-Homo sapiensStimulation15251227
67ATP-sensitive inward rectifier potassium channel 15-Homo sapiensStimulation15251227 | 10990455
68ATP-sensitive inward rectifier potassium channel 8-Homo sapiensStimulation15251227 | 10990455
69SHC transforming protein 2-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
Interacton with GPCRs:
Coupling with GPCRs
NoNameCouplingPubMed