Quick search:







Description Entry page for G-protein - 'Ggamma-13_Homo sapiens'
ClassGgamma
FamilyGgamma
Sub-FamilyGgamma
TypeGgamma-13
Cross References:
References
UniProtQ9P2W3 | B2R5C8 | Q52LX0 | Q9UJJ3
EMBLAY029486 | AB030207 | AF493880 | AK312139 | AE006465 | AL031033 | BC093760 | BC095525
InterProIPR015898 | IPR001770
PRODOMPD003783
GENEID51764
MIM607298
PRINTSPR00321
PFAMPF00631
Details:
Details
NameGgamma-13_Homo sapiens
DescriptionRecName: Full=Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13;Flags: Precursor
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGNG1
FunctionGuanine nucleotide-binding proteins (G proteins) ares involved as a modulator or transducer in various transmembranes signaling systems
Fragment0
Sequence
MEEWDVPQMKKEVESLKYQLAFQREMASKTIPELLKWIEDGIPKDPFLNPDLMKNNPWVE
KGKCTIL
Effectors:
Effectors
NoNameRegulationPubMed
1ATP-sensitive inward rectifier potassium channel 14-Homo sapiensStimulation15251227 | 10990455
2Rac-Homo sapiens-2"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
3Rho-Homo sapiens-3Recruitment to plasma membrane15251227
4Rho-Homo sapiens-1Recruitment to plasma membrane15251227
5PI3K alpha-Homo sapiensPropable Inhibition16182515
6GRK2-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
7Tubulin-Homo sapiens-6Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
8Tubulin-Homo sapiens-16Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
9Voltage dependent P/Q type calcium channel-Homo sapiensInhibition15251227 | 11031246
10ATP-sensitive inward rectifier potassium channel 15-Homo sapiensStimulation15251227 | 10990455
11Calmodulin-Homo sapiensInhibition of calmodulin kinase15251227
12Protein kinase D-Homo sapiensStimulation15251227
13Rac-Homo sapiens-1"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
14Rho-Homo sapiens-2Recruitment to plasma membrane15251227
15ATP-sensitive inward rectifier potassium channel 10-Homo sapiensStimulation15251227 | 10990455
16Tubulin-Homo sapiens-26Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
17Tubulin-Homo sapiens-5Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
18Tubulin-Homo sapiens-3Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
19Tubulin-Homo sapiens-4Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
20PI3K gamma-Homo sapiensActivation12502714
21Brutons tyrosine kinase-Homo sapiensStimulation15251227 | 11698416
22Tubulin-Homo sapiens-21Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
23Tubulin-Homo sapiens-13Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
24ATP-sensitive inward rectifier potassium channel 11-Homo sapiensStimulation15251227 | 10990455
25Tubulin-Homo sapiens-1Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
26Rac-Homo sapiens-3"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
27Ras specific nucleotide exchange factor CDC25-Homo sapiensStimulation (indirect activation of ras)15251227 | 8717044
28Tubulin-Homo sapiens-24Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
29Tubulin-Homo sapiens-19Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
30Tubulin-Homo sapiens-2Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
31SHC transforming protein 1-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
32Phospholipase C beta 3-Homo sapiensStimulation15251227 | 11015615 | 8383116
33Phospholipase C beta 2-Homo sapiensStimulation15251227 | 11015615 | 8383116
34Tubulin-Homo sapiens-20Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
35Tubulin-Homo sapiens-10Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
36Tubulin-Homo sapiens-14Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
37Adenylate cyclase 2-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
38Tubulin-Homo sapiens-27Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
39Tubulin-Homo sapiens-22Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
40Tubulin-Homo sapiens-12Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
41Raf1 protein kinase-Homo sapiensSequestration of G15251227
42Tubulin-Homo sapiens-11Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
43ATP-sensitive inward rectifier potassium channel 1-Homo sapiensStimulation15251227 | 10990455
44PI3K beta-Homo sapiensActivation9305878 | 12502714
45Kinase suppressor of Ras(KSR)-Homo sapiensSequestration of Gbeta/gamma15251227
46Dynamin 1-Homo sapiensIncreased GTPase activity15251227 | 14671004
47Tubulin-Homo sapiens-15Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
48SHC transforming protein 3-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
49Adenylate cyclase 7-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
50ATP-sensitive inward rectifier potassium channel 8-Homo sapiensStimulation15251227 | 10990455
51Adenylate cyclase 6-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
52ATP-sensitive inward rectifier potassium channel 12-Homo sapiensStimulation15251227 | 10990455
53Tubulin-Homo sapiens-7Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
54Tubulin-Homo sapiens-9Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
55GRK3-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
56Adenylate cyclase 1-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933 | 10449730
57Tsk tyrosine kinase-Homo sapiensStimulation15251227 | 14671004
58Cdc42-Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
59SHC transforming protein 2-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
60Tubulin-Homo sapiens-25Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
61Voltage dependent N type calcium channel-Homo sapiensInhibition15251227 | 11031246
62Tubulin-Homo sapiens-8Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
63Tubulin-Homo sapiens-23Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
64Tubulin-Homo sapiens-18Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
65Tubulin-Homo sapiens-17Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
66Voltage dependent R type calcium channel-Homo sapiensInhibition15251227 | 11031246
67Phospholipase C beta 1-Homo sapiensStimulation15251227 | 11015615 | 8383116
68Adenylate cyclase 4-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
69Adenylate cyclase 5-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
Interacton with GPCRs:
Coupling with GPCRs
NoNameCouplingPubMed