Quick search:







Description Entry page for G-protein - 'Ggamma-t1_Homo sapiens'
ClassGgamma
FamilyGgamma
Sub-FamilyGgamma
TypeGgamma-t1
Cross References:
References
UniProtP63211 | O43835 | Q08447 | Q16026
EMBLS62027 | S62026 | AF493869 | CR456912 | AC002076 | BC029367 | U41492
InterProIPR015898 | IPR001770
PRODOMPD003783
GENEID2792
MIM189970
PRINTSPR00321
PFAMPF00631
Details:
Details
NameGgamma-t1_Homo sapiens
DescriptionRecName: Full=Guanine nucleotide-binding protein G(T) subunit gamma-T1;AltName: Full=Transducin gamma chain;Flags: Precursor
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGNGT
FunctionGuanine nucleotide-binding proteins (G proteins) ares involved as a modulator or transducer in various transmembranes signaling systems
Fragment0
Sequence
MPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEVRDYVEERSGEDPLVKGIPED
KNPFKELKGGCVIS
Effectors:
Effectors
NoNameRegulationPubMed
1Calmodulin-Homo sapiensInhibition of calmodulin kinase15251227
2Adenylate cyclase 7-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
3Tubulin-Homo sapiens-3Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
4Tubulin-Homo sapiens-25Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
5PI3K alpha-Homo sapiensPropable Inhibition16182515
6Phospholipase C beta 1-Homo sapiensStimulation15251227 | 11015615 | 8383116
7Dynamin 1-Homo sapiensIncreased GTPase activity15251227 | 14671004
8Tubulin-Homo sapiens-18Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
9Voltage dependent N type calcium channel-Homo sapiensInhibition15251227 | 11031246
10Rho-Homo sapiens-3Recruitment to plasma membrane15251227
11Phospholipase C beta 2-Homo sapiensStimulation15251227 | 11015615 | 8383116
12Tubulin-Homo sapiens-15Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
13PI3K beta-Homo sapiensActivation9305878 | 12502714
14Tsk tyrosine kinase-Homo sapiensStimulation15251227 | 14671004
15Raf1 protein kinase-Homo sapiensSequestration of G15251227
16Rho-Homo sapiens-1Recruitment to plasma membrane15251227
17Tubulin-Homo sapiens-20Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
18Tubulin-Homo sapiens-27Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
19Tubulin-Homo sapiens-16Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
20SHC transforming protein 3-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
21SHC transforming protein 1-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
22Rac-Homo sapiens-2"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
23GRK3-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
24Tubulin-Homo sapiens-26Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
25Tubulin-Homo sapiens-1Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
26Rac-Homo sapiens-3"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
27Tubulin-Homo sapiens-6Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
28Adenylate cyclase 6-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
29Tubulin-Homo sapiens-9Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
30Kinase suppressor of Ras(KSR)-Homo sapiensSequestration of Gbeta/gamma15251227
31Tubulin-Homo sapiens-10Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
32Ras specific nucleotide exchange factor CDC25-Homo sapiensStimulation (indirect activation of ras)15251227 | 8717044
33SHC transforming protein 2-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
34Rho-Homo sapiens-2Recruitment to plasma membrane15251227
35Tubulin-Homo sapiens-14Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
36Tubulin-Homo sapiens-21Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
37Tubulin-Homo sapiens-17Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
38ATP-sensitive inward rectifier potassium channel 14-Homo sapiensStimulation15251227 | 10990455
39Adenylate cyclase 1-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933 | 10449730
40Tubulin-Homo sapiens-2Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
41Tubulin-Homo sapiens-5Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
42ATP-sensitive inward rectifier potassium channel 10-Homo sapiensStimulation15251227 | 10990455
43ATP-sensitive inward rectifier potassium channel 11-Homo sapiensStimulation15251227 | 10990455
44Voltage dependent R type calcium channel-Homo sapiensInhibition15251227 | 11031246
45Phospholipase C beta 3-Homo sapiensStimulation15251227 | 11015615 | 8383116
46Tubulin-Homo sapiens-24Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
47Tubulin-Homo sapiens-4Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
48Adenylate cyclase 2-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
49ATP-sensitive inward rectifier potassium channel 1-Homo sapiensStimulation15251227 | 10990455
50ATP-sensitive inward rectifier potassium channel 12-Homo sapiensStimulation15251227 | 10990455
51Rac-Homo sapiens-1"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
52Tubulin-Homo sapiens-12Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
53ATP-sensitive inward rectifier potassium channel 8-Homo sapiensStimulation15251227 | 10990455
54Tubulin-Homo sapiens-8Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
55Tubulin-Homo sapiens-13Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
56Tubulin-Homo sapiens-22Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
57Voltage dependent P/Q type calcium channel-Homo sapiensInhibition15251227 | 11031246
58Tubulin-Homo sapiens-11Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
59Protein kinase D-Homo sapiensStimulation15251227
60Tubulin-Homo sapiens-7Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
61Adenylate cyclase 5-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
62Tubulin-Homo sapiens-23Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
63PI3K gamma-Homo sapiensActivation12502714
64GRK2-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
65Tubulin-Homo sapiens-19Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
66ATP-sensitive inward rectifier potassium channel 15-Homo sapiensStimulation15251227 | 10990455
67Brutons tyrosine kinase-Homo sapiensStimulation15251227 | 11698416
68Cdc42-Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
69Adenylate cyclase 4-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
Interacton with GPCRs:
Coupling with GPCRs
NoNameCouplingPubMed