Quick search:







Description Entry page for G-protein - 'Ggamma-t1_Homo sapiens'
ClassGgamma
FamilyGgamma
Sub-FamilyGgamma
TypeGgamma-t1
Cross References:
References
UniProtP63211 | O43835 | Q08447 | Q16026
EMBLS62027 | S62026 | AF493869 | CR456912 | AC002076 | BC029367 | U41492
InterProIPR015898 | IPR001770
PRODOMPD003783
GENEID2792
MIM189970
PRINTSPR00321
PFAMPF00631
Details:
Details
NameGgamma-t1_Homo sapiens
DescriptionRecName: Full=Guanine nucleotide-binding protein G(T) subunit gamma-T1;AltName: Full=Transducin gamma chain;Flags: Precursor
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGNGT
FunctionGuanine nucleotide-binding proteins (G proteins) ares involved as a modulator or transducer in various transmembranes signaling systems
Fragment0
Sequence
MPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEVRDYVEERSGEDPLVKGIPED
KNPFKELKGGCVIS
Effectors:
Effectors
NoNameRegulationPubMed
1Tubulin-Homo sapiens-11Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
2SHC transforming protein 1-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
3Tubulin-Homo sapiens-3Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
4Tubulin-Homo sapiens-19Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
5Tubulin-Homo sapiens-23Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
6Tubulin-Homo sapiens-10Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
7Tubulin-Homo sapiens-13Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
8GRK3-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
9Tubulin-Homo sapiens-6Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
10Tubulin-Homo sapiens-9Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
11ATP-sensitive inward rectifier potassium channel 15-Homo sapiensStimulation15251227 | 10990455
12Tubulin-Homo sapiens-16Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
13Rac-Homo sapiens-1"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
14Tubulin-Homo sapiens-12Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
15PI3K gamma-Homo sapiensActivation12502714
16Tubulin-Homo sapiens-20Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
17Phospholipase C beta 2-Homo sapiensStimulation15251227 | 11015615 | 8383116
18Dynamin 1-Homo sapiensIncreased GTPase activity15251227 | 14671004
19ATP-sensitive inward rectifier potassium channel 8-Homo sapiensStimulation15251227 | 10990455
20Rho-Homo sapiens-2Recruitment to plasma membrane15251227
21ATP-sensitive inward rectifier potassium channel 12-Homo sapiensStimulation15251227 | 10990455
22Adenylate cyclase 4-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
23ATP-sensitive inward rectifier potassium channel 10-Homo sapiensStimulation15251227 | 10990455
24Tubulin-Homo sapiens-25Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
25Rho-Homo sapiens-3Recruitment to plasma membrane15251227
26Voltage dependent P/Q type calcium channel-Homo sapiensInhibition15251227 | 11031246
27GRK2-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
28Adenylate cyclase 7-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
29Brutons tyrosine kinase-Homo sapiensStimulation15251227 | 11698416
30Voltage dependent R type calcium channel-Homo sapiensInhibition15251227 | 11031246
31SHC transforming protein 2-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
32Phospholipase C beta 1-Homo sapiensStimulation15251227 | 11015615 | 8383116
33Tubulin-Homo sapiens-21Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
34Tubulin-Homo sapiens-2Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
35Cdc42-Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
36Rac-Homo sapiens-3"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
37Kinase suppressor of Ras(KSR)-Homo sapiensSequestration of Gbeta/gamma15251227
38Voltage dependent N type calcium channel-Homo sapiensInhibition15251227 | 11031246
39Tubulin-Homo sapiens-24Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
40ATP-sensitive inward rectifier potassium channel 11-Homo sapiensStimulation15251227 | 10990455
41ATP-sensitive inward rectifier potassium channel 14-Homo sapiensStimulation15251227 | 10990455
42Tubulin-Homo sapiens-27Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
43Calmodulin-Homo sapiensInhibition of calmodulin kinase15251227
44Tubulin-Homo sapiens-4Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
45Tubulin-Homo sapiens-17Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
46Tubulin-Homo sapiens-5Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
47Adenylate cyclase 5-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
48Rho-Homo sapiens-1Recruitment to plasma membrane15251227
49Ras specific nucleotide exchange factor CDC25-Homo sapiensStimulation (indirect activation of ras)15251227 | 8717044
50SHC transforming protein 3-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
51Tubulin-Homo sapiens-18Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
52Tubulin-Homo sapiens-8Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
53Adenylate cyclase 2-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
54Tubulin-Homo sapiens-1Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
55Tubulin-Homo sapiens-14Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
56PI3K alpha-Homo sapiensPropable Inhibition16182515
57Tsk tyrosine kinase-Homo sapiensStimulation15251227 | 14671004
58Tubulin-Homo sapiens-15Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
59PI3K beta-Homo sapiensActivation9305878 | 12502714
60Tubulin-Homo sapiens-22Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
61ATP-sensitive inward rectifier potassium channel 1-Homo sapiensStimulation15251227 | 10990455
62Protein kinase D-Homo sapiensStimulation15251227
63Adenylate cyclase 1-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933 | 10449730
64Rac-Homo sapiens-2"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
65Raf1 protein kinase-Homo sapiensSequestration of G15251227
66Tubulin-Homo sapiens-26Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
67Adenylate cyclase 6-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
68Tubulin-Homo sapiens-7Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
69Phospholipase C beta 3-Homo sapiensStimulation15251227 | 11015615 | 8383116
Interacton with GPCRs:
Coupling with GPCRs
NoNameCouplingPubMed