Quick search:







Description Entry page for G-protein - 'Galpha-13_Homo sapiens'
ClassGalpha
FamilyG12/13
Sub-FamilyGalpha-13
TypeGalpha-13
Cross References:
References
UniProtQ14344 | Q8TD70
EMBLL22075 | AF493902 | BC036756
InterProIPR001019 | IPR000469
PRODOMPD000281
GENEID10672
MIM604406
PRINTSPR00318 | PR00440
PFAMPF00503
Details:
Details
NameGalpha-13_Homo sapiens
DescriptionRecName: Full=Guanine nucleotide-binding protein subunit alpha-13; Short=G-protein subunit alpha-13; Short=G alpha-13
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGNA1
FunctionGuanine nucleotide-binding proteins (G proteins) ares involved as modulators or transducers in various transmembranes signaling systems
Fragment0
Sequence
MADFLPSRSVLSVCFPGCLLTSGEAEQQRKSKEIDKCLSREKTYVKRLVKILLLGAGESG
KSTFLKQMRIIHGQDFDQRAREEFRPTIYSNVIKGMRVLVDAREKLHIPWGDNSNQQHGD
KMMSFDTRAPMAAQGMVETRVFLQYLPAIRALWADSGIQNAYDRRREFQLGESVKYFLDN
LDKLGEPDYIPSQQDILLARRPTKGIHEYDFEIKNVPFKMVDVGGQRSERKRWFECFDSV
TSILFLVSSSEFDQVLMEDRLTNRLTESLNIFETIVNNRVFSNVSIILFLNKTDLLEEKV
QIVSIKDYFLEFEGDPHCLRDVQKFLVECFRNKRRDQQQKPLYHHFTTAINTENIRLVFR
DVKDTILHDNLKQLMLQ
Effectors:
Effectors
NoNameRegulationPubMed
1E cadherin-Homo sapiensStimulation (stimulation of h-catenin release)15251227 | 14607242 | 11136230
2LARG RhoGEF-Homo sapiensStimulation (indirect activation of Rho and stress fiber formation)15251227 | 12024019 | 14607242
3PDZ RhoGEF-Homo sapiensStimulation (indirect activation of Rho and stress fiber formation)15251227 | 11799111 | 14607242
4Protein kinase D-Homo sapiensStimulation11507098
5p115 RhoGEF-Homo sapiensStimulation (indirect activation of Rho and stress fiber formation)15251227 | 14607242
Interacton with GPCRs:
Coupling with GPCRs
NoNameCouplingPubMed