Quick search:







Description Entry page for G-protein - 'Ggamma-2_Homo sapiens'
ClassGgamma
FamilyGgamma
Sub-FamilyGgamma
TypeGgamma-2
Cross References:
References
UniProtP59768 | Q6P9A9
EMBLAF493870 | BC020774 | BC060856
InterProIPR015898 | IPR001770
PRODOMPD003783
GENEID54331
MIM606981
PRINTSPR00321
PFAMPF00631
Details:
Details
NameGgamma-2_Homo sapiens
DescriptionRecName: Full=Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2;AltName: Full=G gamma-I;Flags: Precursor
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGNG
FunctionGuanine nucleotide-binding proteins (G proteins) ares involved as a modulator or transducer in various transmembranes signaling systems
Fragment0
Sequence
MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENP
FREKKFFCAIL
Effectors:
Effectors
NoNameRegulationPubMed
1Voltage dependent N type calcium channel-Homo sapiensInhibition15251227 | 11031246
2Tubulin-Homo sapiens-13Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
3Voltage dependent R type calcium channel-Homo sapiensInhibition15251227 | 11031246
4Tubulin-Homo sapiens-11Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
5Tubulin-Homo sapiens-18Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
6Tubulin-Homo sapiens-22Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
7GRK3-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
8Tsk tyrosine kinase-Homo sapiensStimulation15251227 | 14671004
9Protein kinase D-Homo sapiensStimulation15251227
10Phospholipase C beta 2-Homo sapiensStimulation15251227 | 11015615 | 8383116
11Phospholipase C beta 1-Homo sapiensStimulation15251227 | 11015615 | 8383116
12ATP-sensitive inward rectifier potassium channel 12-Homo sapiensStimulation15251227 | 10990455
13ATP-sensitive inward rectifier potassium channel 1-Homo sapiensStimulation15251227 | 10990455
14Adenylate cyclase 5-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
15Tubulin-Homo sapiens-19Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
16Cdc42-Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
17SHC transforming protein 3-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
18Tubulin-Homo sapiens-26Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
19SHC transforming protein 2-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
20Phospholipase C beta 3-Homo sapiensStimulation15251227 | 11015615 | 8383116
21Tubulin-Homo sapiens-2Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
22Tubulin-Homo sapiens-23Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
23GRK2-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
24Rac-Homo sapiens-1"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
25Tubulin-Homo sapiens-8Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
26Ras specific nucleotide exchange factor CDC25-Homo sapiensStimulation (indirect activation of ras)15251227 | 8717044
27ATP-sensitive inward rectifier potassium channel 14-Homo sapiensStimulation15251227 | 10990455
28Rho-Homo sapiens-1Recruitment to plasma membrane15251227
29Rac-Homo sapiens-3"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
30Rac-Homo sapiens-2"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
31Raf1 protein kinase-Homo sapiensSequestration of G15251227
32Adenylate cyclase 6-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
33Adenylate cyclase 2-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
34Adenylate cyclase 1-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933 | 10449730
35Tubulin-Homo sapiens-6Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
36PI3K alpha-Homo sapiensPropable Inhibition16182515
37PI3K beta-Homo sapiensActivation9305878 | 12502714
38Tubulin-Homo sapiens-5Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
39Tubulin-Homo sapiens-9Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
40SHC transforming protein 1-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
41Kinase suppressor of Ras(KSR)-Homo sapiensSequestration of Gbeta/gamma15251227
42Calmodulin-Homo sapiensInhibition of calmodulin kinase15251227
43Tubulin-Homo sapiens-16Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
44Tubulin-Homo sapiens-27Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
45ATP-sensitive inward rectifier potassium channel 15-Homo sapiensStimulation15251227 | 10990455
46PI3K gamma-Homo sapiensActivation12502714
47Tubulin-Homo sapiens-1Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
48Rho-Homo sapiens-3Recruitment to plasma membrane15251227
49Adenylate cyclase 4-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
50Tubulin-Homo sapiens-12Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
51Tubulin-Homo sapiens-3Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
52Tubulin-Homo sapiens-25Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
53Tubulin-Homo sapiens-14Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
54Tubulin-Homo sapiens-4Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
55Adenylate cyclase 7-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
56Tubulin-Homo sapiens-15Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
57Tubulin-Homo sapiens-24Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
58Brutons tyrosine kinase-Homo sapiensStimulation15251227 | 11698416
59ATP-sensitive inward rectifier potassium channel 11-Homo sapiensStimulation15251227 | 10990455
60Tubulin-Homo sapiens-7Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
61Tubulin-Homo sapiens-17Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
62Tubulin-Homo sapiens-20Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
63ATP-sensitive inward rectifier potassium channel 10-Homo sapiensStimulation15251227 | 10990455
64Dynamin 1-Homo sapiensIncreased GTPase activity15251227 | 14671004
65ATP-sensitive inward rectifier potassium channel 8-Homo sapiensStimulation15251227 | 10990455
66Tubulin-Homo sapiens-10Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
67Tubulin-Homo sapiens-21Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
68Voltage dependent P/Q type calcium channel-Homo sapiensInhibition15251227 | 11031246
69Rho-Homo sapiens-2Recruitment to plasma membrane15251227
Interacton with GPCRs:
Coupling with GPCRs
NoNameCouplingPubMed