Quick search:







Description Entry page for G-protein - 'Ggamma-2_Homo sapiens'
ClassGgamma
FamilyGgamma
Sub-FamilyGgamma
TypeGgamma-2
Cross References:
References
UniProtP59768 | Q6P9A9
EMBLAF493870 | BC020774 | BC060856
InterProIPR015898 | IPR001770
PRODOMPD003783
GENEID54331
MIM606981
PRINTSPR00321
PFAMPF00631
Details:
Details
NameGgamma-2_Homo sapiens
DescriptionRecName: Full=Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2;AltName: Full=G gamma-I;Flags: Precursor
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGNG
FunctionGuanine nucleotide-binding proteins (G proteins) ares involved as a modulator or transducer in various transmembranes signaling systems
Fragment0
Sequence
MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENP
FREKKFFCAIL
Effectors:
Effectors
NoNameRegulationPubMed
1Rac-Homo sapiens-3"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
2Tubulin-Homo sapiens-15Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
3Tubulin-Homo sapiens-6Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
4Adenylate cyclase 7-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
5Tubulin-Homo sapiens-3Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
6Tubulin-Homo sapiens-11Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
7Cdc42-Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
8Phospholipase C beta 3-Homo sapiensStimulation15251227 | 11015615 | 8383116
9Tubulin-Homo sapiens-14Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
10Rac-Homo sapiens-1"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
11SHC transforming protein 1-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
12Kinase suppressor of Ras(KSR)-Homo sapiensSequestration of Gbeta/gamma15251227
13Tubulin-Homo sapiens-20Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
14Rho-Homo sapiens-1Recruitment to plasma membrane15251227
15Rac-Homo sapiens-2"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
16Tubulin-Homo sapiens-1Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
17Adenylate cyclase 2-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
18Ras specific nucleotide exchange factor CDC25-Homo sapiensStimulation (indirect activation of ras)15251227 | 8717044
19Phospholipase C beta 2-Homo sapiensStimulation15251227 | 11015615 | 8383116
20Protein kinase D-Homo sapiensStimulation15251227
21Tubulin-Homo sapiens-10Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
22Tubulin-Homo sapiens-18Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
23Tubulin-Homo sapiens-7Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
24Tubulin-Homo sapiens-5Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
25Adenylate cyclase 1-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933 | 10449730
26PI3K gamma-Homo sapiensActivation12502714
27ATP-sensitive inward rectifier potassium channel 8-Homo sapiensStimulation15251227 | 10990455
28Tubulin-Homo sapiens-2Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
29Tubulin-Homo sapiens-17Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
30Tubulin-Homo sapiens-9Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
31ATP-sensitive inward rectifier potassium channel 11-Homo sapiensStimulation15251227 | 10990455
32Tubulin-Homo sapiens-22Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
33Tubulin-Homo sapiens-12Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
34Tubulin-Homo sapiens-8Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
35Dynamin 1-Homo sapiensIncreased GTPase activity15251227 | 14671004
36Tubulin-Homo sapiens-16Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
37Adenylate cyclase 6-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
38Tubulin-Homo sapiens-21Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
39Voltage dependent N type calcium channel-Homo sapiensInhibition15251227 | 11031246
40Tubulin-Homo sapiens-4Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
41Brutons tyrosine kinase-Homo sapiensStimulation15251227 | 11698416
42PI3K beta-Homo sapiensActivation9305878 | 12502714
43GRK2-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
44Calmodulin-Homo sapiensInhibition of calmodulin kinase15251227
45SHC transforming protein 2-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
46Rho-Homo sapiens-3Recruitment to plasma membrane15251227
47ATP-sensitive inward rectifier potassium channel 12-Homo sapiensStimulation15251227 | 10990455
48PI3K alpha-Homo sapiensPropable Inhibition16182515
49ATP-sensitive inward rectifier potassium channel 14-Homo sapiensStimulation15251227 | 10990455
50Phospholipase C beta 1-Homo sapiensStimulation15251227 | 11015615 | 8383116
51Rho-Homo sapiens-2Recruitment to plasma membrane15251227
52ATP-sensitive inward rectifier potassium channel 15-Homo sapiensStimulation15251227 | 10990455
53Adenylate cyclase 4-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
54Tubulin-Homo sapiens-19Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
55Tubulin-Homo sapiens-23Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
56Adenylate cyclase 5-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
57ATP-sensitive inward rectifier potassium channel 1-Homo sapiensStimulation15251227 | 10990455
58Voltage dependent P/Q type calcium channel-Homo sapiensInhibition15251227 | 11031246
59Tsk tyrosine kinase-Homo sapiensStimulation15251227 | 14671004
60ATP-sensitive inward rectifier potassium channel 10-Homo sapiensStimulation15251227 | 10990455
61Tubulin-Homo sapiens-27Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
62Raf1 protein kinase-Homo sapiensSequestration of G15251227
63Tubulin-Homo sapiens-26Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
64Tubulin-Homo sapiens-25Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
65GRK3-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
66Tubulin-Homo sapiens-13Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
67Tubulin-Homo sapiens-24Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
68Voltage dependent R type calcium channel-Homo sapiensInhibition15251227 | 11031246
69SHC transforming protein 3-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
Interacton with GPCRs:
Coupling with GPCRs
NoNameCouplingPubMed