Quick search:







Description Entry page for G-protein - 'Ggamma-2_Homo sapiens'
ClassGgamma
FamilyGgamma
Sub-FamilyGgamma
TypeGgamma-2
Cross References:
References
UniProtP59768 | Q6P9A9
EMBLAF493870 | BC020774 | BC060856
InterProIPR015898 | IPR001770
PRODOMPD003783
GENEID54331
MIM606981
PRINTSPR00321
PFAMPF00631
Details:
Details
NameGgamma-2_Homo sapiens
DescriptionRecName: Full=Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2;AltName: Full=G gamma-I;Flags: Precursor
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGNG
FunctionGuanine nucleotide-binding proteins (G proteins) ares involved as a modulator or transducer in various transmembranes signaling systems
Fragment0
Sequence
MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENP
FREKKFFCAIL
Effectors:
Effectors
NoNameRegulationPubMed
1GRK3-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
2Raf1 protein kinase-Homo sapiensSequestration of G15251227
3Tubulin-Homo sapiens-27Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
4Phospholipase C beta 1-Homo sapiensStimulation15251227 | 11015615 | 8383116
5Rho-Homo sapiens-3Recruitment to plasma membrane15251227
6Adenylate cyclase 7-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
7Tubulin-Homo sapiens-24Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
8Adenylate cyclase 1-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933 | 10449730
9Dynamin 1-Homo sapiensIncreased GTPase activity15251227 | 14671004
10Protein kinase D-Homo sapiensStimulation15251227
11Rho-Homo sapiens-2Recruitment to plasma membrane15251227
12Tubulin-Homo sapiens-15Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
13Tubulin-Homo sapiens-21Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
14PI3K gamma-Homo sapiensActivation12502714
15ATP-sensitive inward rectifier potassium channel 10-Homo sapiensStimulation15251227 | 10990455
16Tubulin-Homo sapiens-23Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
17Rac-Homo sapiens-2"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
18Ras specific nucleotide exchange factor CDC25-Homo sapiensStimulation (indirect activation of ras)15251227 | 8717044
19Tubulin-Homo sapiens-10Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
20Tsk tyrosine kinase-Homo sapiensStimulation15251227 | 14671004
21Tubulin-Homo sapiens-6Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
22Adenylate cyclase 6-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
23Calmodulin-Homo sapiensInhibition of calmodulin kinase15251227
24Adenylate cyclase 2-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
25Tubulin-Homo sapiens-13Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
26Tubulin-Homo sapiens-19Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
27SHC transforming protein 2-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
28Tubulin-Homo sapiens-16Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
29Rac-Homo sapiens-3"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
30GRK2-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
31Tubulin-Homo sapiens-1Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
32Tubulin-Homo sapiens-9Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
33ATP-sensitive inward rectifier potassium channel 1-Homo sapiensStimulation15251227 | 10990455
34Tubulin-Homo sapiens-11Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
35Voltage dependent N type calcium channel-Homo sapiensInhibition15251227 | 11031246
36Tubulin-Homo sapiens-5Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
37SHC transforming protein 3-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
38Cdc42-Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
39Tubulin-Homo sapiens-8Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
40PI3K beta-Homo sapiensActivation9305878 | 12502714
41Voltage dependent R type calcium channel-Homo sapiensInhibition15251227 | 11031246
42Tubulin-Homo sapiens-14Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
43Tubulin-Homo sapiens-17Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
44Rho-Homo sapiens-1Recruitment to plasma membrane15251227
45Tubulin-Homo sapiens-26Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
46Tubulin-Homo sapiens-2Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
47Phospholipase C beta 3-Homo sapiensStimulation15251227 | 11015615 | 8383116
48Tubulin-Homo sapiens-25Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
49Tubulin-Homo sapiens-3Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
50Tubulin-Homo sapiens-7Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
51Tubulin-Homo sapiens-20Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
52ATP-sensitive inward rectifier potassium channel 8-Homo sapiensStimulation15251227 | 10990455
53SHC transforming protein 1-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
54Adenylate cyclase 5-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
55Rac-Homo sapiens-1"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
56Tubulin-Homo sapiens-12Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
57Tubulin-Homo sapiens-18Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
58ATP-sensitive inward rectifier potassium channel 14-Homo sapiensStimulation15251227 | 10990455
59Tubulin-Homo sapiens-4Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
60PI3K alpha-Homo sapiensPropable Inhibition16182515
61ATP-sensitive inward rectifier potassium channel 15-Homo sapiensStimulation15251227 | 10990455
62Kinase suppressor of Ras(KSR)-Homo sapiensSequestration of Gbeta/gamma15251227
63ATP-sensitive inward rectifier potassium channel 12-Homo sapiensStimulation15251227 | 10990455
64Tubulin-Homo sapiens-22Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
65Voltage dependent P/Q type calcium channel-Homo sapiensInhibition15251227 | 11031246
66Brutons tyrosine kinase-Homo sapiensStimulation15251227 | 11698416
67ATP-sensitive inward rectifier potassium channel 11-Homo sapiensStimulation15251227 | 10990455
68Phospholipase C beta 2-Homo sapiensStimulation15251227 | 11015615 | 8383116
69Adenylate cyclase 4-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
Interacton with GPCRs:
Coupling with GPCRs
NoNameCouplingPubMed