Quick search:







Description Entry page for G-protein - 'Ggamma-3_Homo sapiens'
ClassGgamma
FamilyGgamma
Sub-FamilyGgamma
TypeGgamma-3
Cross References:
References
UniProtP63215 | B2R4S7 | P29798 | Q61014
EMBLAF092129 | AF188177 | AF087900 | AF493871 | AK311933 | CH471076 | BC015563
InterProIPR015898 | IPR001770
PRODOMPD003783
GENEID2785
MIM608941
PRINTSPR00321
PFAMPF00631
Details:
Details
NameGgamma-3_Homo sapiens
DescriptionRecName: Full=Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3;Flags: Precursor
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGNG3 | GNGT
FunctionGuanine nucleotide-binding proteins (G proteins) ares involved as a modulator or transducer in various transmembranes signaling systems
Fragment0
Sequence
MKGETPVNSTMSIGQARKMVEQLKIEASLCRIKVSKAAADLMTYCDAHACEDPLITPVPT
SENPFREKKFFCALL
Effectors:
Effectors
NoNameRegulationPubMed
1Tubulin-Homo sapiens-18Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
2Brutons tyrosine kinase-Homo sapiensStimulation15251227 | 11698416
3Tubulin-Homo sapiens-22Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
4Tsk tyrosine kinase-Homo sapiensStimulation15251227 | 14671004
5Protein kinase D-Homo sapiensStimulation15251227
6Rho-Homo sapiens-2Recruitment to plasma membrane15251227
7Tubulin-Homo sapiens-25Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
8Tubulin-Homo sapiens-27Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
9ATP-sensitive inward rectifier potassium channel 8-Homo sapiensStimulation15251227 | 10990455
10Tubulin-Homo sapiens-15Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
11Tubulin-Homo sapiens-3Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
12Tubulin-Homo sapiens-9Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
13ATP-sensitive inward rectifier potassium channel 15-Homo sapiensStimulation15251227 | 10990455
14Adenylate cyclase 7-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
15Raf1 protein kinase-Homo sapiensSequestration of G15251227
16ATP-sensitive inward rectifier potassium channel 12-Homo sapiensStimulation15251227 | 10990455
17Phospholipase C beta 2-Homo sapiensStimulation15251227 | 11015615 | 8383116
18Tubulin-Homo sapiens-4Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
19Tubulin-Homo sapiens-20Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
20Adenylate cyclase 6-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
21Rho-Homo sapiens-1Recruitment to plasma membrane15251227
22Adenylate cyclase 2-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
23Rho-Homo sapiens-3Recruitment to plasma membrane15251227
24Tubulin-Homo sapiens-14Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
25Phospholipase C beta 3-Homo sapiensStimulation15251227 | 11015615 | 8383116
26ATP-sensitive inward rectifier potassium channel 14-Homo sapiensStimulation15251227 | 10990455
27Cdc42-Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
28Tubulin-Homo sapiens-8Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
29Tubulin-Homo sapiens-16Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
30Tubulin-Homo sapiens-21Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
31Tubulin-Homo sapiens-7Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
32Voltage dependent R type calcium channel-Homo sapiensInhibition15251227 | 11031246
33ATP-sensitive inward rectifier potassium channel 11-Homo sapiensStimulation15251227 | 10990455
34SHC transforming protein 3-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
35PI3K alpha-Homo sapiensPropable Inhibition16182515
36Adenylate cyclase 5-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
37Rac-Homo sapiens-1"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
38Tubulin-Homo sapiens-17Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
39Kinase suppressor of Ras(KSR)-Homo sapiensSequestration of Gbeta/gamma15251227
40Tubulin-Homo sapiens-2Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
41Tubulin-Homo sapiens-24Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
42Tubulin-Homo sapiens-12Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
43Tubulin-Homo sapiens-10Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
44Tubulin-Homo sapiens-26Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
45Adenylate cyclase 1-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933 | 10449730
46Tubulin-Homo sapiens-5Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
47Tubulin-Homo sapiens-6Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
48PI3K beta-Homo sapiensActivation9305878 | 12502714
49Ras specific nucleotide exchange factor CDC25-Homo sapiensStimulation (indirect activation of ras)15251227 | 8717044
50ATP-sensitive inward rectifier potassium channel 1-Homo sapiensStimulation15251227 | 10990455
51Adenylate cyclase 4-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
52SHC transforming protein 1-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
53Dynamin 1-Homo sapiensIncreased GTPase activity15251227 | 14671004
54ATP-sensitive inward rectifier potassium channel 10-Homo sapiensStimulation15251227 | 10990455
55Calmodulin-Homo sapiensInhibition of calmodulin kinase15251227
56Tubulin-Homo sapiens-11Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
57SHC transforming protein 2-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
58GRK3-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
59Tubulin-Homo sapiens-13Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
60Rac-Homo sapiens-2"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
61GRK2-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
62Tubulin-Homo sapiens-19Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
63Tubulin-Homo sapiens-23Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
64Rac-Homo sapiens-3"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
65Phospholipase C beta 1-Homo sapiensStimulation15251227 | 11015615 | 8383116
66Tubulin-Homo sapiens-1Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
67Voltage dependent N type calcium channel-Homo sapiensInhibition15251227 | 11031246
68Voltage dependent P/Q type calcium channel-Homo sapiensInhibition15251227 | 11031246
69PI3K gamma-Homo sapiensActivation12502714
Interacton with GPCRs:
Coupling with GPCRs
NoNameCouplingPubMed