Quick search:







Description Entry page for G-protein - 'Ggamma-3_Homo sapiens'
ClassGgamma
FamilyGgamma
Sub-FamilyGgamma
TypeGgamma-3
Cross References:
References
UniProtP63215 | B2R4S7 | P29798 | Q61014
EMBLAF092129 | AF188177 | AF087900 | AF493871 | AK311933 | CH471076 | BC015563
InterProIPR015898 | IPR001770
PRODOMPD003783
GENEID2785
MIM608941
PRINTSPR00321
PFAMPF00631
Details:
Details
NameGgamma-3_Homo sapiens
DescriptionRecName: Full=Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3;Flags: Precursor
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGNG3 | GNGT
FunctionGuanine nucleotide-binding proteins (G proteins) ares involved as a modulator or transducer in various transmembranes signaling systems
Fragment0
Sequence
MKGETPVNSTMSIGQARKMVEQLKIEASLCRIKVSKAAADLMTYCDAHACEDPLITPVPT
SENPFREKKFFCALL
Effectors:
Effectors
NoNameRegulationPubMed
1Tubulin-Homo sapiens-6Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
2Rac-Homo sapiens-1"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
3Rac-Homo sapiens-2"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
4Voltage dependent N type calcium channel-Homo sapiensInhibition15251227 | 11031246
5Tubulin-Homo sapiens-25Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
6Adenylate cyclase 2-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
7Tubulin-Homo sapiens-7Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
8Tubulin-Homo sapiens-5Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
9Protein kinase D-Homo sapiensStimulation15251227
10Adenylate cyclase 4-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
11GRK3-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
12Tubulin-Homo sapiens-19Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
13Tubulin-Homo sapiens-23Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
14Raf1 protein kinase-Homo sapiensSequestration of G15251227
15Tubulin-Homo sapiens-8Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
16Rho-Homo sapiens-2Recruitment to plasma membrane15251227
17Tubulin-Homo sapiens-16Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
18Tsk tyrosine kinase-Homo sapiensStimulation15251227 | 14671004
19Kinase suppressor of Ras(KSR)-Homo sapiensSequestration of Gbeta/gamma15251227
20Voltage dependent P/Q type calcium channel-Homo sapiensInhibition15251227 | 11031246
21SHC transforming protein 1-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
22ATP-sensitive inward rectifier potassium channel 11-Homo sapiensStimulation15251227 | 10990455
23Rho-Homo sapiens-3Recruitment to plasma membrane15251227
24Tubulin-Homo sapiens-1Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
25ATP-sensitive inward rectifier potassium channel 15-Homo sapiensStimulation15251227 | 10990455
26Tubulin-Homo sapiens-4Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
27Voltage dependent R type calcium channel-Homo sapiensInhibition15251227 | 11031246
28Tubulin-Homo sapiens-15Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
29Tubulin-Homo sapiens-14Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
30Tubulin-Homo sapiens-12Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
31Adenylate cyclase 1-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933 | 10449730
32Dynamin 1-Homo sapiensIncreased GTPase activity15251227 | 14671004
33Calmodulin-Homo sapiensInhibition of calmodulin kinase15251227
34PI3K gamma-Homo sapiensActivation12502714
35Tubulin-Homo sapiens-18Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
36Tubulin-Homo sapiens-3Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
37Phospholipase C beta 1-Homo sapiensStimulation15251227 | 11015615 | 8383116
38Phospholipase C beta 3-Homo sapiensStimulation15251227 | 11015615 | 8383116
39Tubulin-Homo sapiens-22Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
40ATP-sensitive inward rectifier potassium channel 10-Homo sapiensStimulation15251227 | 10990455
41Adenylate cyclase 7-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
42Brutons tyrosine kinase-Homo sapiensStimulation15251227 | 11698416
43Tubulin-Homo sapiens-11Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
44PI3K beta-Homo sapiensActivation9305878 | 12502714
45Rac-Homo sapiens-3"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
46Tubulin-Homo sapiens-17Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
47ATP-sensitive inward rectifier potassium channel 8-Homo sapiensStimulation15251227 | 10990455
48Tubulin-Homo sapiens-27Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
49Phospholipase C beta 2-Homo sapiensStimulation15251227 | 11015615 | 8383116
50Tubulin-Homo sapiens-2Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
51SHC transforming protein 2-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
52GRK2-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
53Tubulin-Homo sapiens-21Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
54Tubulin-Homo sapiens-26Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
55Tubulin-Homo sapiens-10Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
56ATP-sensitive inward rectifier potassium channel 1-Homo sapiensStimulation15251227 | 10990455
57Tubulin-Homo sapiens-20Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
58Cdc42-Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
59SHC transforming protein 3-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
60Tubulin-Homo sapiens-13Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
61Rho-Homo sapiens-1Recruitment to plasma membrane15251227
62ATP-sensitive inward rectifier potassium channel 12-Homo sapiensStimulation15251227 | 10990455
63PI3K alpha-Homo sapiensPropable Inhibition16182515
64Adenylate cyclase 6-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
65Adenylate cyclase 5-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
66ATP-sensitive inward rectifier potassium channel 14-Homo sapiensStimulation15251227 | 10990455
67Tubulin-Homo sapiens-24Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
68Ras specific nucleotide exchange factor CDC25-Homo sapiensStimulation (indirect activation of ras)15251227 | 8717044
69Tubulin-Homo sapiens-9Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
Interacton with GPCRs:
Coupling with GPCRs
NoNameCouplingPubMed