Quick search:







Description Entry page for G-protein - 'Ggamma-3_Homo sapiens'
ClassGgamma
FamilyGgamma
Sub-FamilyGgamma
TypeGgamma-3
Cross References:
References
UniProtP63215 | B2R4S7 | P29798 | Q61014
EMBLAF092129 | AF188177 | AF087900 | AF493871 | AK311933 | CH471076 | BC015563
InterProIPR015898 | IPR001770
PRODOMPD003783
GENEID2785
MIM608941
PRINTSPR00321
PFAMPF00631
Details:
Details
NameGgamma-3_Homo sapiens
DescriptionRecName: Full=Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3;Flags: Precursor
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGNG3 | GNGT
FunctionGuanine nucleotide-binding proteins (G proteins) ares involved as a modulator or transducer in various transmembranes signaling systems
Fragment0
Sequence
MKGETPVNSTMSIGQARKMVEQLKIEASLCRIKVSKAAADLMTYCDAHACEDPLITPVPT
SENPFREKKFFCALL
Effectors:
Effectors
NoNameRegulationPubMed
1Tubulin-Homo sapiens-2Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
2Adenylate cyclase 5-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
3Ras specific nucleotide exchange factor CDC25-Homo sapiensStimulation (indirect activation of ras)15251227 | 8717044
4Tubulin-Homo sapiens-7Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
5GRK2-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
6ATP-sensitive inward rectifier potassium channel 15-Homo sapiensStimulation15251227 | 10990455
7Tubulin-Homo sapiens-27Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
8Tubulin-Homo sapiens-10Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
9Tubulin-Homo sapiens-3Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
10Phospholipase C beta 1-Homo sapiensStimulation15251227 | 11015615 | 8383116
11PI3K alpha-Homo sapiensPropable Inhibition16182515
12Tubulin-Homo sapiens-18Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
13Tubulin-Homo sapiens-22Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
14Calmodulin-Homo sapiensInhibition of calmodulin kinase15251227
15ATP-sensitive inward rectifier potassium channel 12-Homo sapiensStimulation15251227 | 10990455
16Tubulin-Homo sapiens-14Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
17ATP-sensitive inward rectifier potassium channel 1-Homo sapiensStimulation15251227 | 10990455
18Tsk tyrosine kinase-Homo sapiensStimulation15251227 | 14671004
19Voltage dependent N type calcium channel-Homo sapiensInhibition15251227 | 11031246
20SHC transforming protein 2-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
21Tubulin-Homo sapiens-24Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
22Adenylate cyclase 2-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
23Kinase suppressor of Ras(KSR)-Homo sapiensSequestration of Gbeta/gamma15251227
24Rho-Homo sapiens-1Recruitment to plasma membrane15251227
25Voltage dependent R type calcium channel-Homo sapiensInhibition15251227 | 11031246
26ATP-sensitive inward rectifier potassium channel 14-Homo sapiensStimulation15251227 | 10990455
27ATP-sensitive inward rectifier potassium channel 11-Homo sapiensStimulation15251227 | 10990455
28Phospholipase C beta 2-Homo sapiensStimulation15251227 | 11015615 | 8383116
29Rho-Homo sapiens-3Recruitment to plasma membrane15251227
30Cdc42-Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
31Tubulin-Homo sapiens-4Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
32SHC transforming protein 1-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
33Tubulin-Homo sapiens-21Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
34Tubulin-Homo sapiens-8Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
35Tubulin-Homo sapiens-13Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
36Phospholipase C beta 3-Homo sapiensStimulation15251227 | 11015615 | 8383116
37Tubulin-Homo sapiens-25Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
38Tubulin-Homo sapiens-15Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
39Adenylate cyclase 6-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
40ATP-sensitive inward rectifier potassium channel 10-Homo sapiensStimulation15251227 | 10990455
41Tubulin-Homo sapiens-1Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
42Dynamin 1-Homo sapiensIncreased GTPase activity15251227 | 14671004
43ATP-sensitive inward rectifier potassium channel 8-Homo sapiensStimulation15251227 | 10990455
44Tubulin-Homo sapiens-6Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
45Rac-Homo sapiens-3"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
46GRK3-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
47Rac-Homo sapiens-2"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
48PI3K beta-Homo sapiensActivation9305878 | 12502714
49Adenylate cyclase 4-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
50Tubulin-Homo sapiens-26Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
51Adenylate cyclase 7-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
52Tubulin-Homo sapiens-5Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
53Voltage dependent P/Q type calcium channel-Homo sapiensInhibition15251227 | 11031246
54Tubulin-Homo sapiens-19Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
55Tubulin-Homo sapiens-11Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
56Tubulin-Homo sapiens-9Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
57Tubulin-Homo sapiens-23Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
58PI3K gamma-Homo sapiensActivation12502714
59SHC transforming protein 3-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
60Tubulin-Homo sapiens-17Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
61Protein kinase D-Homo sapiensStimulation15251227
62Tubulin-Homo sapiens-12Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
63Raf1 protein kinase-Homo sapiensSequestration of G15251227
64Tubulin-Homo sapiens-20Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
65Tubulin-Homo sapiens-16Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
66Adenylate cyclase 1-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933 | 10449730
67Rho-Homo sapiens-2Recruitment to plasma membrane15251227
68Brutons tyrosine kinase-Homo sapiensStimulation15251227 | 11698416
69Rac-Homo sapiens-1"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
Interacton with GPCRs:
Coupling with GPCRs
NoNameCouplingPubMed