Quick search:







Description Entry page for G-protein - 'Ggamma-4_Homo sapiens'
ClassGgamma
FamilyGgamma
Sub-FamilyGgamma
TypeGgamma-4
Cross References:
References
UniProtP50150
EMBLU31382 | AF493872 | BC022485
InterProIPR015898 | IPR001770
PRODOMPD003783
GENEID2786
MIM604388
PRINTSPR00321
PFAMPF00631
Details:
Details
NameGgamma-4_Homo sapiens
DescriptionRecName: Full=Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-4;Flags: Precursor
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGNG4 | GNGT
FunctionGuanine nucleotide-binding proteins (G proteins) ares involved as a modulator or transducer in various transmembranes signaling systems
Fragment0
Sequence
MKEGMSNNSTTSISQARKAVEQLKMEACMDRVKVSQAAADLLAYCEAHVREDPLIIPVPA
SENPFREKKFFCTIL
Effectors:
Effectors
NoNameRegulationPubMed
1Adenylate cyclase 7-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
2ATP-sensitive inward rectifier potassium channel 1-Homo sapiensStimulation15251227 | 10990455
3ATP-sensitive inward rectifier potassium channel 8-Homo sapiensStimulation15251227 | 10990455
4Phospholipase C beta 1-Homo sapiensStimulation15251227 | 11015615 | 8383116
5Dynamin 1-Homo sapiensIncreased GTPase activity15251227 | 14671004
6Tubulin-Homo sapiens-19Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
7Rho-Homo sapiens-2Recruitment to plasma membrane15251227
8Ras specific nucleotide exchange factor CDC25-Homo sapiensStimulation (indirect activation of ras)15251227 | 8717044
9Rac-Homo sapiens-1"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
10Tubulin-Homo sapiens-16Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
11Tubulin-Homo sapiens-4Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
12Tubulin-Homo sapiens-1Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
13Tubulin-Homo sapiens-10Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
14ATP-sensitive inward rectifier potassium channel 10-Homo sapiensStimulation15251227 | 10990455
15Tubulin-Homo sapiens-13Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
16SHC transforming protein 2-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
17Voltage dependent R type calcium channel-Homo sapiensInhibition15251227 | 11031246
18SHC transforming protein 1-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
19ATP-sensitive inward rectifier potassium channel 12-Homo sapiensStimulation15251227 | 10990455
20Adenylate cyclase 1-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933 | 10449730
21Tubulin-Homo sapiens-3Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
22Tubulin-Homo sapiens-14Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
23Tubulin-Homo sapiens-7Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
24Voltage dependent P/Q type calcium channel-Homo sapiensInhibition15251227 | 11031246
25Adenylate cyclase 4-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
26Adenylate cyclase 2-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
27Protein kinase D-Homo sapiensStimulation15251227
28Tubulin-Homo sapiens-26Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
29Tubulin-Homo sapiens-9Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
30ATP-sensitive inward rectifier potassium channel 11-Homo sapiensStimulation15251227 | 10990455
31Rho-Homo sapiens-1Recruitment to plasma membrane15251227
32Brutons tyrosine kinase-Homo sapiensStimulation15251227 | 11698416
33Phospholipase C beta 3-Homo sapiensStimulation15251227 | 11015615 | 8383116
34Cdc42-Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
35Tubulin-Homo sapiens-15Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
36SHC transforming protein 3-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
37Rac-Homo sapiens-3"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
38Voltage dependent N type calcium channel-Homo sapiensInhibition15251227 | 11031246
39Raf1 protein kinase-Homo sapiensSequestration of G15251227
40Tubulin-Homo sapiens-24Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
41PI3K gamma-Homo sapiensActivation12502714
42Tubulin-Homo sapiens-5Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
43Tubulin-Homo sapiens-8Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
44Tubulin-Homo sapiens-18Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
45PI3K alpha-Homo sapiensPropable Inhibition16182515
46Adenylate cyclase 6-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
47Tubulin-Homo sapiens-20Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
48Tubulin-Homo sapiens-12Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
49Rho-Homo sapiens-3Recruitment to plasma membrane15251227
50PI3K beta-Homo sapiensActivation9305878 | 12502714
51Tubulin-Homo sapiens-11Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
52Tubulin-Homo sapiens-22Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
53Phospholipase C beta 2-Homo sapiensStimulation15251227 | 11015615 | 8383116
54Adenylate cyclase 5-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
55Tubulin-Homo sapiens-6Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
56Tsk tyrosine kinase-Homo sapiensStimulation15251227 | 14671004
57Rac-Homo sapiens-2"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
58Calmodulin-Homo sapiensInhibition of calmodulin kinase15251227
59Tubulin-Homo sapiens-21Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
60ATP-sensitive inward rectifier potassium channel 14-Homo sapiensStimulation15251227 | 10990455
61Tubulin-Homo sapiens-2Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
62GRK2-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
63Tubulin-Homo sapiens-27Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
64Tubulin-Homo sapiens-23Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
65Tubulin-Homo sapiens-25Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
66GRK3-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
67Tubulin-Homo sapiens-17Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
68Kinase suppressor of Ras(KSR)-Homo sapiensSequestration of Gbeta/gamma15251227
69ATP-sensitive inward rectifier potassium channel 15-Homo sapiensStimulation15251227 | 10990455
Interacton with GPCRs:
Coupling with GPCRs
NoNameCouplingPubMed