Quick search:







Description Entry page for G-protein - 'Ggamma-4_Homo sapiens'
ClassGgamma
FamilyGgamma
Sub-FamilyGgamma
TypeGgamma-4
Cross References:
References
UniProtP50150
EMBLU31382 | AF493872 | BC022485
InterProIPR015898 | IPR001770
PRODOMPD003783
GENEID2786
MIM604388
PRINTSPR00321
PFAMPF00631
Details:
Details
NameGgamma-4_Homo sapiens
DescriptionRecName: Full=Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-4;Flags: Precursor
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGNG4 | GNGT
FunctionGuanine nucleotide-binding proteins (G proteins) ares involved as a modulator or transducer in various transmembranes signaling systems
Fragment0
Sequence
MKEGMSNNSTTSISQARKAVEQLKMEACMDRVKVSQAAADLLAYCEAHVREDPLIIPVPA
SENPFREKKFFCTIL
Effectors:
Effectors
NoNameRegulationPubMed
1Tubulin-Homo sapiens-27Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
2Tubulin-Homo sapiens-23Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
3Tubulin-Homo sapiens-13Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
4Tubulin-Homo sapiens-6Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
5SHC transforming protein 1-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
6Tubulin-Homo sapiens-1Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
7Adenylate cyclase 5-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
8ATP-sensitive inward rectifier potassium channel 1-Homo sapiensStimulation15251227 | 10990455
9Tubulin-Homo sapiens-25Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
10Tubulin-Homo sapiens-5Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
11ATP-sensitive inward rectifier potassium channel 12-Homo sapiensStimulation15251227 | 10990455
12Tubulin-Homo sapiens-26Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
13Adenylate cyclase 6-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
14Rho-Homo sapiens-1Recruitment to plasma membrane15251227
15PI3K beta-Homo sapiensActivation9305878 | 12502714
16Tubulin-Homo sapiens-14Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
17SHC transforming protein 3-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
18Tubulin-Homo sapiens-8Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
19Adenylate cyclase 4-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
20Tubulin-Homo sapiens-9Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
21Raf1 protein kinase-Homo sapiensSequestration of G15251227
22Calmodulin-Homo sapiensInhibition of calmodulin kinase15251227
23Adenylate cyclase 1-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933 | 10449730
24Phospholipase C beta 1-Homo sapiensStimulation15251227 | 11015615 | 8383116
25Tubulin-Homo sapiens-21Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
26Cdc42-Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
27Tubulin-Homo sapiens-4Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
28Tubulin-Homo sapiens-17Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
29ATP-sensitive inward rectifier potassium channel 14-Homo sapiensStimulation15251227 | 10990455
30GRK3-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
31Phospholipase C beta 2-Homo sapiensStimulation15251227 | 11015615 | 8383116
32Tsk tyrosine kinase-Homo sapiensStimulation15251227 | 14671004
33Tubulin-Homo sapiens-22Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
34Rac-Homo sapiens-3"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
35ATP-sensitive inward rectifier potassium channel 8-Homo sapiensStimulation15251227 | 10990455
36Dynamin 1-Homo sapiensIncreased GTPase activity15251227 | 14671004
37Tubulin-Homo sapiens-3Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
38GRK2-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
39Tubulin-Homo sapiens-15Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
40Tubulin-Homo sapiens-10Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
41Adenylate cyclase 7-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
42Tubulin-Homo sapiens-11Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
43ATP-sensitive inward rectifier potassium channel 11-Homo sapiensStimulation15251227 | 10990455
44Voltage dependent P/Q type calcium channel-Homo sapiensInhibition15251227 | 11031246
45Tubulin-Homo sapiens-7Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
46PI3K alpha-Homo sapiensPropable Inhibition16182515
47Rho-Homo sapiens-2Recruitment to plasma membrane15251227
48Tubulin-Homo sapiens-18Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
49SHC transforming protein 2-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
50Ras specific nucleotide exchange factor CDC25-Homo sapiensStimulation (indirect activation of ras)15251227 | 8717044
51Tubulin-Homo sapiens-16Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
52Rac-Homo sapiens-2"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
53Kinase suppressor of Ras(KSR)-Homo sapiensSequestration of Gbeta/gamma15251227
54Voltage dependent R type calcium channel-Homo sapiensInhibition15251227 | 11031246
55Tubulin-Homo sapiens-24Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
56Rac-Homo sapiens-1"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
57Rho-Homo sapiens-3Recruitment to plasma membrane15251227
58Voltage dependent N type calcium channel-Homo sapiensInhibition15251227 | 11031246
59Brutons tyrosine kinase-Homo sapiensStimulation15251227 | 11698416
60Tubulin-Homo sapiens-12Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
61Tubulin-Homo sapiens-20Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
62ATP-sensitive inward rectifier potassium channel 10-Homo sapiensStimulation15251227 | 10990455
63Phospholipase C beta 3-Homo sapiensStimulation15251227 | 11015615 | 8383116
64Tubulin-Homo sapiens-2Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
65ATP-sensitive inward rectifier potassium channel 15-Homo sapiensStimulation15251227 | 10990455
66PI3K gamma-Homo sapiensActivation12502714
67Adenylate cyclase 2-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
68Tubulin-Homo sapiens-19Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
69Protein kinase D-Homo sapiensStimulation15251227
Interacton with GPCRs:
Coupling with GPCRs
NoNameCouplingPubMed