Quick search:







Description Entry page for G-protein - 'Ggamma-4_Homo sapiens'
ClassGgamma
FamilyGgamma
Sub-FamilyGgamma
TypeGgamma-4
Cross References:
References
UniProtP50150
EMBLU31382 | AF493872 | BC022485
InterProIPR015898 | IPR001770
PRODOMPD003783
GENEID2786
MIM604388
PRINTSPR00321
PFAMPF00631
Details:
Details
NameGgamma-4_Homo sapiens
DescriptionRecName: Full=Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-4;Flags: Precursor
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGNG4 | GNGT
FunctionGuanine nucleotide-binding proteins (G proteins) ares involved as a modulator or transducer in various transmembranes signaling systems
Fragment0
Sequence
MKEGMSNNSTTSISQARKAVEQLKMEACMDRVKVSQAAADLLAYCEAHVREDPLIIPVPA
SENPFREKKFFCTIL
Effectors:
Effectors
NoNameRegulationPubMed
1Tubulin-Homo sapiens-15Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
2Tubulin-Homo sapiens-1Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
3Tubulin-Homo sapiens-6Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
4ATP-sensitive inward rectifier potassium channel 8-Homo sapiensStimulation15251227 | 10990455
5Tubulin-Homo sapiens-26Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
6Adenylate cyclase 7-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
7Phospholipase C beta 2-Homo sapiensStimulation15251227 | 11015615 | 8383116
8Tubulin-Homo sapiens-7Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
9Kinase suppressor of Ras(KSR)-Homo sapiensSequestration of Gbeta/gamma15251227
10ATP-sensitive inward rectifier potassium channel 15-Homo sapiensStimulation15251227 | 10990455
11Tubulin-Homo sapiens-19Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
12Voltage dependent N type calcium channel-Homo sapiensInhibition15251227 | 11031246
13ATP-sensitive inward rectifier potassium channel 10-Homo sapiensStimulation15251227 | 10990455
14Ras specific nucleotide exchange factor CDC25-Homo sapiensStimulation (indirect activation of ras)15251227 | 8717044
15Tubulin-Homo sapiens-14Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
16Tubulin-Homo sapiens-21Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
17Rac-Homo sapiens-1"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
18Phospholipase C beta 3-Homo sapiensStimulation15251227 | 11015615 | 8383116
19Tubulin-Homo sapiens-17Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
20GRK2-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
21Tubulin-Homo sapiens-13Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
22Tubulin-Homo sapiens-9Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
23Adenylate cyclase 4-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
24ATP-sensitive inward rectifier potassium channel 1-Homo sapiensStimulation15251227 | 10990455
25PI3K alpha-Homo sapiensPropable Inhibition16182515
26PI3K beta-Homo sapiensActivation9305878 | 12502714
27Brutons tyrosine kinase-Homo sapiensStimulation15251227 | 11698416
28Rho-Homo sapiens-1Recruitment to plasma membrane15251227
29Rac-Homo sapiens-3"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
30Voltage dependent R type calcium channel-Homo sapiensInhibition15251227 | 11031246
31ATP-sensitive inward rectifier potassium channel 14-Homo sapiensStimulation15251227 | 10990455
32Rho-Homo sapiens-2Recruitment to plasma membrane15251227
33Tubulin-Homo sapiens-10Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
34Voltage dependent P/Q type calcium channel-Homo sapiensInhibition15251227 | 11031246
35SHC transforming protein 2-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
36Tubulin-Homo sapiens-3Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
37SHC transforming protein 1-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
38GRK3-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
39Tubulin-Homo sapiens-4Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
40Adenylate cyclase 6-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
41Adenylate cyclase 2-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
42Tubulin-Homo sapiens-5Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
43Tubulin-Homo sapiens-22Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
44Protein kinase D-Homo sapiensStimulation15251227
45Rho-Homo sapiens-3Recruitment to plasma membrane15251227
46SHC transforming protein 3-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
47Tubulin-Homo sapiens-24Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
48Tubulin-Homo sapiens-23Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
49Tubulin-Homo sapiens-8Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
50Raf1 protein kinase-Homo sapiensSequestration of G15251227
51Rac-Homo sapiens-2"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
52Tubulin-Homo sapiens-18Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
53Dynamin 1-Homo sapiensIncreased GTPase activity15251227 | 14671004
54Tubulin-Homo sapiens-20Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
55Tsk tyrosine kinase-Homo sapiensStimulation15251227 | 14671004
56Phospholipase C beta 1-Homo sapiensStimulation15251227 | 11015615 | 8383116
57Tubulin-Homo sapiens-11Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
58Tubulin-Homo sapiens-16Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
59Adenylate cyclase 5-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
60Adenylate cyclase 1-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933 | 10449730
61PI3K gamma-Homo sapiensActivation12502714
62ATP-sensitive inward rectifier potassium channel 11-Homo sapiensStimulation15251227 | 10990455
63Calmodulin-Homo sapiensInhibition of calmodulin kinase15251227
64Tubulin-Homo sapiens-25Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
65Tubulin-Homo sapiens-12Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
66ATP-sensitive inward rectifier potassium channel 12-Homo sapiensStimulation15251227 | 10990455
67Cdc42-Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
68Tubulin-Homo sapiens-2Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
69Tubulin-Homo sapiens-27Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
Interacton with GPCRs:
Coupling with GPCRs
NoNameCouplingPubMed