Quick search:







Description Entry page for G-protein - 'Ggamma-5_Homo sapiens'
ClassGgamma
FamilyGgamma
Sub-FamilyGgamma
TypeGgamma-5
Cross References:
References
UniProtP63218 | B2R5A0 | P30670 | Q5VX54 | Q61015
EMBLAF085709 | AF085708 | AF038955 | AF493873 | BT006823 | AK312111 | AL359762 | CH471097 | BC003563
InterProIPR015898 | IPR001770
PRODOMPD003783
GENEID2787
MIM600874
PRINTSPR00321
PFAMPF00631
Details:
Details
NameGgamma-5_Homo sapiens
DescriptionRecName: Full=Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5;Flags: Precursor
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGNG5 | GNGT
FunctionGuanine nucleotide-binding proteins (G proteins) ares involved as a modulator or transducer in various transmembranes signaling systems
Fragment0
Sequence
MSGSSSVAAMKKVVQQLRLEAGLNRVKVSQAAADLKQFCLQNAQHDPLLTGVSSSTNPFR
PQKVCSFL
Effectors:
Effectors
NoNameRegulationPubMed
1Kinase suppressor of Ras(KSR)-Homo sapiensSequestration of Gbeta/gamma15251227
2Tubulin-Homo sapiens-3Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
3Rho-Homo sapiens-3Recruitment to plasma membrane15251227
4Tubulin-Homo sapiens-22Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
5Rac-Homo sapiens-1"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
6Raf1 protein kinase-Homo sapiensSequestration of G15251227
7Tubulin-Homo sapiens-11Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
8PI3K beta-Homo sapiensActivation9305878 | 12502714
9Protein kinase D-Homo sapiensStimulation15251227
10Rac-Homo sapiens-3"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
11ATP-sensitive inward rectifier potassium channel 1-Homo sapiensStimulation15251227 | 10990455
12Tubulin-Homo sapiens-12Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
13ATP-sensitive inward rectifier potassium channel 12-Homo sapiensStimulation15251227 | 10990455
14ATP-sensitive inward rectifier potassium channel 8-Homo sapiensStimulation15251227 | 10990455
15Tubulin-Homo sapiens-8Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
16Tubulin-Homo sapiens-19Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
17Tubulin-Homo sapiens-13Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
18Tubulin-Homo sapiens-2Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
19Tubulin-Homo sapiens-20Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
20Rho-Homo sapiens-1Recruitment to plasma membrane15251227
21Tubulin-Homo sapiens-16Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
22Tubulin-Homo sapiens-1Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
23SHC transforming protein 3-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
24SHC transforming protein 1-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
25Adenylate cyclase 6-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
26Tubulin-Homo sapiens-25Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
27GRK2-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
28Adenylate cyclase 2-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
29Adenylate cyclase 5-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
30Voltage dependent N type calcium channel-Homo sapiensInhibition15251227 | 11031246
31Dynamin 1-Homo sapiensIncreased GTPase activity15251227 | 14671004
32Tubulin-Homo sapiens-17Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
33Tubulin-Homo sapiens-5Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
34Tubulin-Homo sapiens-4Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
35Rho-Homo sapiens-2Recruitment to plasma membrane15251227
36ATP-sensitive inward rectifier potassium channel 11-Homo sapiensStimulation15251227 | 10990455
37Rac-Homo sapiens-2"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
38Tubulin-Homo sapiens-24Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
39Tubulin-Homo sapiens-14Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
40ATP-sensitive inward rectifier potassium channel 14-Homo sapiensStimulation15251227 | 10990455
41Tsk tyrosine kinase-Homo sapiensStimulation15251227 | 14671004
42Adenylate cyclase 1-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933 | 10449730
43Tubulin-Homo sapiens-9Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
44Brutons tyrosine kinase-Homo sapiensStimulation15251227 | 11698416
45Tubulin-Homo sapiens-27Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
46Calmodulin-Homo sapiensInhibition of calmodulin kinase15251227
47PI3K gamma-Homo sapiensActivation12502714
48PI3K alpha-Homo sapiensPropable Inhibition16182515
49SHC transforming protein 2-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
50Tubulin-Homo sapiens-10Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
51Voltage dependent R type calcium channel-Homo sapiensInhibition15251227 | 11031246
52Tubulin-Homo sapiens-18Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
53Ras specific nucleotide exchange factor CDC25-Homo sapiensStimulation (indirect activation of ras)15251227 | 8717044
54Tubulin-Homo sapiens-6Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
55Tubulin-Homo sapiens-21Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
56Phospholipase C beta 1-Homo sapiensStimulation15251227 | 11015615 | 8383116
57Adenylate cyclase 4-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
58Tubulin-Homo sapiens-7Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
59Tubulin-Homo sapiens-26Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
60Adenylate cyclase 7-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
61Tubulin-Homo sapiens-23Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
62Phospholipase C beta 2-Homo sapiensStimulation15251227 | 11015615 | 8383116
63Cdc42-Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
64GRK3-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
65Phospholipase C beta 3-Homo sapiensStimulation15251227 | 11015615 | 8383116
66ATP-sensitive inward rectifier potassium channel 10-Homo sapiensStimulation15251227 | 10990455
67ATP-sensitive inward rectifier potassium channel 15-Homo sapiensStimulation15251227 | 10990455
68Voltage dependent P/Q type calcium channel-Homo sapiensInhibition15251227 | 11031246
69Tubulin-Homo sapiens-15Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
Interacton with GPCRs:
Coupling with GPCRs
NoNameCouplingPubMed