Quick search:







Description Entry page for G-protein - 'Ggamma-5_Homo sapiens'
ClassGgamma
FamilyGgamma
Sub-FamilyGgamma
TypeGgamma-5
Cross References:
References
UniProtP63218 | B2R5A0 | P30670 | Q5VX54 | Q61015
EMBLAF085709 | AF085708 | AF038955 | AF493873 | BT006823 | AK312111 | AL359762 | CH471097 | BC003563
InterProIPR015898 | IPR001770
PRODOMPD003783
GENEID2787
MIM600874
PRINTSPR00321
PFAMPF00631
Details:
Details
NameGgamma-5_Homo sapiens
DescriptionRecName: Full=Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5;Flags: Precursor
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGNG5 | GNGT
FunctionGuanine nucleotide-binding proteins (G proteins) ares involved as a modulator or transducer in various transmembranes signaling systems
Fragment0
Sequence
MSGSSSVAAMKKVVQQLRLEAGLNRVKVSQAAADLKQFCLQNAQHDPLLTGVSSSTNPFR
PQKVCSFL
Effectors:
Effectors
NoNameRegulationPubMed
1Tubulin-Homo sapiens-1Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
2Adenylate cyclase 1-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933 | 10449730
3Tubulin-Homo sapiens-21Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
4ATP-sensitive inward rectifier potassium channel 8-Homo sapiensStimulation15251227 | 10990455
5ATP-sensitive inward rectifier potassium channel 14-Homo sapiensStimulation15251227 | 10990455
6ATP-sensitive inward rectifier potassium channel 15-Homo sapiensStimulation15251227 | 10990455
7SHC transforming protein 3-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
8Adenylate cyclase 6-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
9Rho-Homo sapiens-1Recruitment to plasma membrane15251227
10Tubulin-Homo sapiens-2Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
11ATP-sensitive inward rectifier potassium channel 1-Homo sapiensStimulation15251227 | 10990455
12Brutons tyrosine kinase-Homo sapiensStimulation15251227 | 11698416
13ATP-sensitive inward rectifier potassium channel 12-Homo sapiensStimulation15251227 | 10990455
14Tubulin-Homo sapiens-20Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
15Tubulin-Homo sapiens-4Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
16Rho-Homo sapiens-2Recruitment to plasma membrane15251227
17Tubulin-Homo sapiens-19Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
18Tubulin-Homo sapiens-3Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
19Cdc42-Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
20Tubulin-Homo sapiens-6Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
21Dynamin 1-Homo sapiensIncreased GTPase activity15251227 | 14671004
22PI3K beta-Homo sapiensActivation9305878 | 12502714
23GRK3-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
24Protein kinase D-Homo sapiensStimulation15251227
25Phospholipase C beta 3-Homo sapiensStimulation15251227 | 11015615 | 8383116
26Tubulin-Homo sapiens-24Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
27Rho-Homo sapiens-3Recruitment to plasma membrane15251227
28Tubulin-Homo sapiens-12Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
29Tubulin-Homo sapiens-27Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
30SHC transforming protein 1-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
31PI3K alpha-Homo sapiensPropable Inhibition16182515
32ATP-sensitive inward rectifier potassium channel 11-Homo sapiensStimulation15251227 | 10990455
33Adenylate cyclase 7-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
34Tubulin-Homo sapiens-14Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
35ATP-sensitive inward rectifier potassium channel 10-Homo sapiensStimulation15251227 | 10990455
36Adenylate cyclase 5-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
37Tubulin-Homo sapiens-11Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
38Calmodulin-Homo sapiensInhibition of calmodulin kinase15251227
39Tubulin-Homo sapiens-23Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
40Rac-Homo sapiens-2"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
41Phospholipase C beta 2-Homo sapiensStimulation15251227 | 11015615 | 8383116
42Tubulin-Homo sapiens-16Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
43Tubulin-Homo sapiens-10Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
44Tubulin-Homo sapiens-18Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
45Adenylate cyclase 4-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
46Tubulin-Homo sapiens-8Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
47Tubulin-Homo sapiens-9Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
48Tubulin-Homo sapiens-26Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
49Tsk tyrosine kinase-Homo sapiensStimulation15251227 | 14671004
50Voltage dependent R type calcium channel-Homo sapiensInhibition15251227 | 11031246
51Rac-Homo sapiens-1"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
52GRK2-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
53Rac-Homo sapiens-3"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
54Ras specific nucleotide exchange factor CDC25-Homo sapiensStimulation (indirect activation of ras)15251227 | 8717044
55Tubulin-Homo sapiens-22Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
56Tubulin-Homo sapiens-15Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
57Tubulin-Homo sapiens-17Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
58SHC transforming protein 2-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
59PI3K gamma-Homo sapiensActivation12502714
60Kinase suppressor of Ras(KSR)-Homo sapiensSequestration of Gbeta/gamma15251227
61Voltage dependent P/Q type calcium channel-Homo sapiensInhibition15251227 | 11031246
62Raf1 protein kinase-Homo sapiensSequestration of G15251227
63Tubulin-Homo sapiens-13Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
64Adenylate cyclase 2-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
65Tubulin-Homo sapiens-25Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
66Voltage dependent N type calcium channel-Homo sapiensInhibition15251227 | 11031246
67Tubulin-Homo sapiens-7Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
68Tubulin-Homo sapiens-5Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
69Phospholipase C beta 1-Homo sapiensStimulation15251227 | 11015615 | 8383116
Interacton with GPCRs:
Coupling with GPCRs
NoNameCouplingPubMed