Quick search:







Description Entry page for G-protein - 'Ggamma-5_Homo sapiens'
ClassGgamma
FamilyGgamma
Sub-FamilyGgamma
TypeGgamma-5
Cross References:
References
UniProtP63218 | B2R5A0 | P30670 | Q5VX54 | Q61015
EMBLAF085709 | AF085708 | AF038955 | AF493873 | BT006823 | AK312111 | AL359762 | CH471097 | BC003563
InterProIPR015898 | IPR001770
PRODOMPD003783
GENEID2787
MIM600874
PRINTSPR00321
PFAMPF00631
Details:
Details
NameGgamma-5_Homo sapiens
DescriptionRecName: Full=Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5;Flags: Precursor
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGNG5 | GNGT
FunctionGuanine nucleotide-binding proteins (G proteins) ares involved as a modulator or transducer in various transmembranes signaling systems
Fragment0
Sequence
MSGSSSVAAMKKVVQQLRLEAGLNRVKVSQAAADLKQFCLQNAQHDPLLTGVSSSTNPFR
PQKVCSFL
Effectors:
Effectors
NoNameRegulationPubMed
1Kinase suppressor of Ras(KSR)-Homo sapiensSequestration of Gbeta/gamma15251227
2Tubulin-Homo sapiens-22Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
3Tubulin-Homo sapiens-4Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
4PI3K alpha-Homo sapiensPropable Inhibition16182515
5Tubulin-Homo sapiens-14Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
6SHC transforming protein 3-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
7Adenylate cyclase 1-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933 | 10449730
8Phospholipase C beta 3-Homo sapiensStimulation15251227 | 11015615 | 8383116
9Tubulin-Homo sapiens-23Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
10Tubulin-Homo sapiens-12Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
11ATP-sensitive inward rectifier potassium channel 11-Homo sapiensStimulation15251227 | 10990455
12PI3K gamma-Homo sapiensActivation12502714
13Tubulin-Homo sapiens-13Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
14Adenylate cyclase 7-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
15Tubulin-Homo sapiens-6Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
16ATP-sensitive inward rectifier potassium channel 8-Homo sapiensStimulation15251227 | 10990455
17SHC transforming protein 2-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
18Rho-Homo sapiens-2Recruitment to plasma membrane15251227
19Tubulin-Homo sapiens-26Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
20Ras specific nucleotide exchange factor CDC25-Homo sapiensStimulation (indirect activation of ras)15251227 | 8717044
21Protein kinase D-Homo sapiensStimulation15251227
22Rac-Homo sapiens-3"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
23Voltage dependent P/Q type calcium channel-Homo sapiensInhibition15251227 | 11031246
24Brutons tyrosine kinase-Homo sapiensStimulation15251227 | 11698416
25GRK2-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
26Tubulin-Homo sapiens-24Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
27Tubulin-Homo sapiens-15Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
28Tubulin-Homo sapiens-20Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
29Phospholipase C beta 2-Homo sapiensStimulation15251227 | 11015615 | 8383116
30Adenylate cyclase 5-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
31Rho-Homo sapiens-1Recruitment to plasma membrane15251227
32Rac-Homo sapiens-1"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
33Tsk tyrosine kinase-Homo sapiensStimulation15251227 | 14671004
34SHC transforming protein 1-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
35Raf1 protein kinase-Homo sapiensSequestration of G15251227
36Adenylate cyclase 6-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
37Adenylate cyclase 4-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
38ATP-sensitive inward rectifier potassium channel 12-Homo sapiensStimulation15251227 | 10990455
39Tubulin-Homo sapiens-18Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
40ATP-sensitive inward rectifier potassium channel 10-Homo sapiensStimulation15251227 | 10990455
41Tubulin-Homo sapiens-27Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
42ATP-sensitive inward rectifier potassium channel 1-Homo sapiensStimulation15251227 | 10990455
43Rac-Homo sapiens-2"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
44Tubulin-Homo sapiens-9Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
45Calmodulin-Homo sapiensInhibition of calmodulin kinase15251227
46Cdc42-Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
47Tubulin-Homo sapiens-5Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
48ATP-sensitive inward rectifier potassium channel 14-Homo sapiensStimulation15251227 | 10990455
49Tubulin-Homo sapiens-16Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
50Dynamin 1-Homo sapiensIncreased GTPase activity15251227 | 14671004
51Adenylate cyclase 2-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
52PI3K beta-Homo sapiensActivation9305878 | 12502714
53Tubulin-Homo sapiens-7Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
54Rho-Homo sapiens-3Recruitment to plasma membrane15251227
55GRK3-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
56Phospholipase C beta 1-Homo sapiensStimulation15251227 | 11015615 | 8383116
57Voltage dependent N type calcium channel-Homo sapiensInhibition15251227 | 11031246
58Tubulin-Homo sapiens-3Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
59ATP-sensitive inward rectifier potassium channel 15-Homo sapiensStimulation15251227 | 10990455
60Tubulin-Homo sapiens-10Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
61Tubulin-Homo sapiens-17Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
62Tubulin-Homo sapiens-25Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
63Tubulin-Homo sapiens-11Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
64Tubulin-Homo sapiens-19Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
65Tubulin-Homo sapiens-8Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
66Voltage dependent R type calcium channel-Homo sapiensInhibition15251227 | 11031246
67Tubulin-Homo sapiens-21Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
68Tubulin-Homo sapiens-1Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
69Tubulin-Homo sapiens-2Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
Interacton with GPCRs:
Coupling with GPCRs
NoNameCouplingPubMed