Quick search:







Description Entry page for G-protein - 'Ggamma-7_Homo sapiens'
ClassGgamma
FamilyGgamma
Sub-FamilyGgamma
TypeGgamma-7
Cross References:
References
UniProtO60262 | B2R496
EMBLAB010414 | AF493874 | AK311750 | AC005512 | BC014466 | BC053630
InterProIPR015898 | IPR001770
PRODOMPD003783
GENEID2788
MIM604430
PRINTSPR00321
PFAMPF00631
Details:
Details
NameGgamma-7_Homo sapiens
DescriptionRecName: Full=Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7;Flags: Precursor
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGNG7 | GNGT
FunctionGuanine nucleotide-binding proteins (G proteins) ares involved as a modulator or transducer in various transmembranes signaling systems
Fragment0
Sequence
MSATNNIAQARKLVEQLRIEAGIERIKVSKAASDLMSYCEQHARNDPLLVGVPASENPFK
DKKPCIIL
Effectors:
Effectors
NoNameRegulationPubMed
1GRK3-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
2Tubulin-Homo sapiens-8Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
3Tubulin-Homo sapiens-3Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
4Tubulin-Homo sapiens-7Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
5Phospholipase C beta 2-Homo sapiensStimulation15251227 | 11015615 | 8383116
6Rho-Homo sapiens-3Recruitment to plasma membrane15251227
7PI3K beta-Homo sapiensActivation9305878 | 12502714
8Tubulin-Homo sapiens-25Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
9ATP-sensitive inward rectifier potassium channel 11-Homo sapiensStimulation15251227 | 10990455
10Brutons tyrosine kinase-Homo sapiensStimulation15251227 | 11698416
11ATP-sensitive inward rectifier potassium channel 15-Homo sapiensStimulation15251227 | 10990455
12Adenylate cyclase 6-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
13Voltage dependent P/Q type calcium channel-Homo sapiensInhibition15251227 | 11031246
14ATP-sensitive inward rectifier potassium channel 10-Homo sapiensStimulation15251227 | 10990455
15Phospholipase C beta 1-Homo sapiensStimulation15251227 | 11015615 | 8383116
16Adenylate cyclase 4-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
17Tubulin-Homo sapiens-12Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
18Rac-Homo sapiens-1"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
19PI3K gamma-Homo sapiensActivation12502714
20GRK2-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
21Tubulin-Homo sapiens-21Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
22ATP-sensitive inward rectifier potassium channel 1-Homo sapiensStimulation15251227 | 10990455
23ATP-sensitive inward rectifier potassium channel 8-Homo sapiensStimulation15251227 | 10990455
24Cdc42-Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
25SHC transforming protein 1-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
26Tsk tyrosine kinase-Homo sapiensStimulation15251227 | 14671004
27Tubulin-Homo sapiens-1Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
28Tubulin-Homo sapiens-23Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
29ATP-sensitive inward rectifier potassium channel 12-Homo sapiensStimulation15251227 | 10990455
30Tubulin-Homo sapiens-9Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
31Rac-Homo sapiens-3"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
32Voltage dependent N type calcium channel-Homo sapiensInhibition15251227 | 11031246
33Adenylate cyclase 1-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933 | 10449730
34Tubulin-Homo sapiens-20Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
35Tubulin-Homo sapiens-5Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
36SHC transforming protein 3-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
37Rac-Homo sapiens-2"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
38Tubulin-Homo sapiens-10Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
39Kinase suppressor of Ras(KSR)-Homo sapiensSequestration of Gbeta/gamma15251227
40Tubulin-Homo sapiens-19Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
41PI3K alpha-Homo sapiensPropable Inhibition16182515
42Tubulin-Homo sapiens-27Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
43Dynamin 1-Homo sapiensIncreased GTPase activity15251227 | 14671004
44Phospholipase C beta 3-Homo sapiensStimulation15251227 | 11015615 | 8383116
45Tubulin-Homo sapiens-18Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
46Protein kinase D-Homo sapiensStimulation15251227
47Tubulin-Homo sapiens-26Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
48Tubulin-Homo sapiens-22Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
49Tubulin-Homo sapiens-4Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
50Tubulin-Homo sapiens-11Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
51Tubulin-Homo sapiens-13Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
52Raf1 protein kinase-Homo sapiensSequestration of G15251227
53Voltage dependent R type calcium channel-Homo sapiensInhibition15251227 | 11031246
54Calmodulin-Homo sapiensInhibition of calmodulin kinase15251227
55Adenylate cyclase 7-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
56Tubulin-Homo sapiens-16Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
57Tubulin-Homo sapiens-2Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
58Rho-Homo sapiens-2Recruitment to plasma membrane15251227
59Tubulin-Homo sapiens-6Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
60Rho-Homo sapiens-1Recruitment to plasma membrane15251227
61Adenylate cyclase 2-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
62ATP-sensitive inward rectifier potassium channel 14-Homo sapiensStimulation15251227 | 10990455
63Adenylate cyclase 5-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
64Tubulin-Homo sapiens-17Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
65Ras specific nucleotide exchange factor CDC25-Homo sapiensStimulation (indirect activation of ras)15251227 | 8717044
66Tubulin-Homo sapiens-24Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
67Tubulin-Homo sapiens-14Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
68SHC transforming protein 2-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
69Tubulin-Homo sapiens-15Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
Interacton with GPCRs:
Coupling with GPCRs
NoNameCouplingPubMed