Quick search:







Description Entry page for G-protein - 'Ggamma-7_Homo sapiens'
ClassGgamma
FamilyGgamma
Sub-FamilyGgamma
TypeGgamma-7
Cross References:
References
UniProtO60262 | B2R496
EMBLAB010414 | AF493874 | AK311750 | AC005512 | BC014466 | BC053630
InterProIPR015898 | IPR001770
PRODOMPD003783
GENEID2788
MIM604430
PRINTSPR00321
PFAMPF00631
Details:
Details
NameGgamma-7_Homo sapiens
DescriptionRecName: Full=Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7;Flags: Precursor
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGNG7 | GNGT
FunctionGuanine nucleotide-binding proteins (G proteins) ares involved as a modulator or transducer in various transmembranes signaling systems
Fragment0
Sequence
MSATNNIAQARKLVEQLRIEAGIERIKVSKAASDLMSYCEQHARNDPLLVGVPASENPFK
DKKPCIIL
Effectors:
Effectors
NoNameRegulationPubMed
1Adenylate cyclase 1-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933 | 10449730
2Tubulin-Homo sapiens-14Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
3SHC transforming protein 3-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
4Rac-Homo sapiens-3"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
5Tubulin-Homo sapiens-15Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
6PI3K beta-Homo sapiensActivation9305878 | 12502714
7ATP-sensitive inward rectifier potassium channel 14-Homo sapiensStimulation15251227 | 10990455
8Tubulin-Homo sapiens-24Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
9Raf1 protein kinase-Homo sapiensSequestration of G15251227
10Dynamin 1-Homo sapiensIncreased GTPase activity15251227 | 14671004
11Rac-Homo sapiens-1"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
12ATP-sensitive inward rectifier potassium channel 10-Homo sapiensStimulation15251227 | 10990455
13Rho-Homo sapiens-2Recruitment to plasma membrane15251227
14Adenylate cyclase 5-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
15Protein kinase D-Homo sapiensStimulation15251227
16ATP-sensitive inward rectifier potassium channel 11-Homo sapiensStimulation15251227 | 10990455
17Tubulin-Homo sapiens-10Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
18Tubulin-Homo sapiens-26Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
19ATP-sensitive inward rectifier potassium channel 1-Homo sapiensStimulation15251227 | 10990455
20Tubulin-Homo sapiens-9Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
21Tubulin-Homo sapiens-7Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
22Tubulin-Homo sapiens-4Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
23Tubulin-Homo sapiens-5Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
24GRK2-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
25ATP-sensitive inward rectifier potassium channel 8-Homo sapiensStimulation15251227 | 10990455
26Tubulin-Homo sapiens-22Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
27Tubulin-Homo sapiens-25Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
28Voltage dependent P/Q type calcium channel-Homo sapiensInhibition15251227 | 11031246
29Tubulin-Homo sapiens-12Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
30Tubulin-Homo sapiens-16Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
31Phospholipase C beta 3-Homo sapiensStimulation15251227 | 11015615 | 8383116
32ATP-sensitive inward rectifier potassium channel 15-Homo sapiensStimulation15251227 | 10990455
33Tubulin-Homo sapiens-27Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
34Tubulin-Homo sapiens-17Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
35Rho-Homo sapiens-1Recruitment to plasma membrane15251227
36Tubulin-Homo sapiens-3Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
37Tubulin-Homo sapiens-18Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
38Calmodulin-Homo sapiensInhibition of calmodulin kinase15251227
39Brutons tyrosine kinase-Homo sapiensStimulation15251227 | 11698416
40Adenylate cyclase 4-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
41Tubulin-Homo sapiens-6Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
42Tubulin-Homo sapiens-13Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
43Voltage dependent R type calcium channel-Homo sapiensInhibition15251227 | 11031246
44Kinase suppressor of Ras(KSR)-Homo sapiensSequestration of Gbeta/gamma15251227
45Ras specific nucleotide exchange factor CDC25-Homo sapiensStimulation (indirect activation of ras)15251227 | 8717044
46SHC transforming protein 1-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
47Rho-Homo sapiens-3Recruitment to plasma membrane15251227
48Cdc42-Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
49Voltage dependent N type calcium channel-Homo sapiensInhibition15251227 | 11031246
50Phospholipase C beta 1-Homo sapiensStimulation15251227 | 11015615 | 8383116
51Tsk tyrosine kinase-Homo sapiensStimulation15251227 | 14671004
52Rac-Homo sapiens-2"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
53Tubulin-Homo sapiens-21Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
54ATP-sensitive inward rectifier potassium channel 12-Homo sapiensStimulation15251227 | 10990455
55Tubulin-Homo sapiens-8Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
56Tubulin-Homo sapiens-11Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
57Tubulin-Homo sapiens-1Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
58Tubulin-Homo sapiens-19Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
59Adenylate cyclase 6-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
60GRK3-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
61Phospholipase C beta 2-Homo sapiensStimulation15251227 | 11015615 | 8383116
62PI3K gamma-Homo sapiensActivation12502714
63Tubulin-Homo sapiens-2Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
64Tubulin-Homo sapiens-20Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
65SHC transforming protein 2-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
66Adenylate cyclase 7-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
67Tubulin-Homo sapiens-23Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
68PI3K alpha-Homo sapiensPropable Inhibition16182515
69Adenylate cyclase 2-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
Interacton with GPCRs:
Coupling with GPCRs
NoNameCouplingPubMed