Quick search:







Description Entry page for G-protein - 'Ggamma-t2_Homo sapiens'
ClassGgamma
FamilyGgamma
Sub-FamilyGgamma
TypeGgamma-t2
Cross References:
References
UniProtO14610 | B2R746
EMBLAF001160 | AF001159 | AF365870 | AF493876 | AK312839 | CH471109 | BC008663
InterProIPR015898 | IPR001770
PRODOMPD003783
GENEID2793
MIM603655
PRINTSPR00321
PFAMPF00631
Details:
Details
NameGgamma-t2_Homo sapiens
DescriptionRecName: Full=Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2;AltName: Full=G gamma-C;AltName: Full=G-gamma-8;AltName: Full=G-gamma-9;Flags: Precursor
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGNGT2 | GNG8,GNG9,GNGT
FunctionGuanine nucleotide-binding proteins (G proteins) ares involved as a modulator or transducer in various transmembranes signaling systems
Fragment0
Sequence
MAQDLSEKDLLKMEVEQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPF
KEKGGCLIS
Effectors:
Effectors
NoNameRegulationPubMed
1PI3K beta-Homo sapiensActivation9305878 | 12502714
2Tsk tyrosine kinase-Homo sapiensStimulation15251227 | 14671004
3GRK3-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
4Voltage dependent R type calcium channel-Homo sapiensInhibition15251227 | 11031246
5Cdc42-Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
6Tubulin-Homo sapiens-22Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
7Tubulin-Homo sapiens-20Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
8PI3K alpha-Homo sapiensPropable Inhibition16182515
9PI3K gamma-Homo sapiensActivation12502714
10Tubulin-Homo sapiens-9Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
11Voltage dependent P/Q type calcium channel-Homo sapiensInhibition15251227 | 11031246
12ATP-sensitive inward rectifier potassium channel 12-Homo sapiensStimulation15251227 | 10990455
13Rho-Homo sapiens-2Recruitment to plasma membrane15251227
14Rho-Homo sapiens-1Recruitment to plasma membrane15251227
15Tubulin-Homo sapiens-25Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
16Tubulin-Homo sapiens-1Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
17Rac-Homo sapiens-3"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
18Tubulin-Homo sapiens-23Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
19ATP-sensitive inward rectifier potassium channel 15-Homo sapiensStimulation15251227 | 10990455
20Tubulin-Homo sapiens-14Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
21GRK2-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
22Phospholipase C beta 3-Homo sapiensStimulation15251227 | 11015615 | 8383116
23Tubulin-Homo sapiens-10Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
24Brutons tyrosine kinase-Homo sapiensStimulation15251227 | 11698416
25Adenylate cyclase 7-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
26Tubulin-Homo sapiens-6Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
27Tubulin-Homo sapiens-16Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
28SHC transforming protein 1-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
29Tubulin-Homo sapiens-13Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
30Tubulin-Homo sapiens-24Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
31SHC transforming protein 3-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
32Tubulin-Homo sapiens-11Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
33Tubulin-Homo sapiens-2Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
34Tubulin-Homo sapiens-18Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
35Phospholipase C beta 1-Homo sapiensStimulation15251227 | 11015615 | 8383116
36ATP-sensitive inward rectifier potassium channel 11-Homo sapiensStimulation15251227 | 10990455
37Tubulin-Homo sapiens-15Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
38Tubulin-Homo sapiens-4Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
39Kinase suppressor of Ras(KSR)-Homo sapiensSequestration of Gbeta/gamma15251227
40Tubulin-Homo sapiens-26Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
41Adenylate cyclase 4-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
42Tubulin-Homo sapiens-19Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
43ATP-sensitive inward rectifier potassium channel 8-Homo sapiensStimulation15251227 | 10990455
44Tubulin-Homo sapiens-5Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
45Tubulin-Homo sapiens-3Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
46Rac-Homo sapiens-2"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
47SHC transforming protein 2-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
48Phospholipase C beta 2-Homo sapiensStimulation15251227 | 11015615 | 8383116
49Tubulin-Homo sapiens-27Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
50ATP-sensitive inward rectifier potassium channel 1-Homo sapiensStimulation15251227 | 10990455
51Tubulin-Homo sapiens-7Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
52Calmodulin-Homo sapiensInhibition of calmodulin kinase15251227
53Tubulin-Homo sapiens-12Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
54Voltage dependent N type calcium channel-Homo sapiensInhibition15251227 | 11031246
55Raf1 protein kinase-Homo sapiensSequestration of G15251227
56ATP-sensitive inward rectifier potassium channel 14-Homo sapiensStimulation15251227 | 10990455
57Rac-Homo sapiens-1"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
58Tubulin-Homo sapiens-21Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
59Rho-Homo sapiens-3Recruitment to plasma membrane15251227
60Tubulin-Homo sapiens-17Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
61Protein kinase D-Homo sapiensStimulation15251227
62Ras specific nucleotide exchange factor CDC25-Homo sapiensStimulation (indirect activation of ras)15251227 | 8717044
63Adenylate cyclase 5-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
64Dynamin 1-Homo sapiensIncreased GTPase activity15251227 | 14671004
65ATP-sensitive inward rectifier potassium channel 10-Homo sapiensStimulation15251227 | 10990455
66Adenylate cyclase 6-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
67Adenylate cyclase 1-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933 | 10449730
68Adenylate cyclase 2-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
69Tubulin-Homo sapiens-8Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
Interacton with GPCRs:
Coupling with GPCRs
NoNameCouplingPubMed