Quick search:







Description Entry page for G-protein - 'Ggamma-t2_Homo sapiens'
ClassGgamma
FamilyGgamma
Sub-FamilyGgamma
TypeGgamma-t2
Cross References:
References
UniProtO14610 | B2R746
EMBLAF001160 | AF001159 | AF365870 | AF493876 | AK312839 | CH471109 | BC008663
InterProIPR015898 | IPR001770
PRODOMPD003783
GENEID2793
MIM603655
PRINTSPR00321
PFAMPF00631
Details:
Details
NameGgamma-t2_Homo sapiens
DescriptionRecName: Full=Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2;AltName: Full=G gamma-C;AltName: Full=G-gamma-8;AltName: Full=G-gamma-9;Flags: Precursor
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGNGT2 | GNG8,GNG9,GNGT
FunctionGuanine nucleotide-binding proteins (G proteins) ares involved as a modulator or transducer in various transmembranes signaling systems
Fragment0
Sequence
MAQDLSEKDLLKMEVEQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPF
KEKGGCLIS
Effectors:
Effectors
NoNameRegulationPubMed
1Kinase suppressor of Ras(KSR)-Homo sapiensSequestration of Gbeta/gamma15251227
2Tubulin-Homo sapiens-9Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
3Tubulin-Homo sapiens-14Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
4Rac-Homo sapiens-1"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
5ATP-sensitive inward rectifier potassium channel 14-Homo sapiensStimulation15251227 | 10990455
6Tubulin-Homo sapiens-20Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
7Tubulin-Homo sapiens-18Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
8Adenylate cyclase 2-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
9Adenylate cyclase 7-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
10Phospholipase C beta 1-Homo sapiensStimulation15251227 | 11015615 | 8383116
11Brutons tyrosine kinase-Homo sapiensStimulation15251227 | 11698416
12Voltage dependent P/Q type calcium channel-Homo sapiensInhibition15251227 | 11031246
13SHC transforming protein 1-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
14PI3K gamma-Homo sapiensActivation12502714
15Rac-Homo sapiens-3"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
16Tubulin-Homo sapiens-19Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
17ATP-sensitive inward rectifier potassium channel 8-Homo sapiensStimulation15251227 | 10990455
18Tubulin-Homo sapiens-10Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
19GRK3-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
20Tubulin-Homo sapiens-5Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
21Raf1 protein kinase-Homo sapiensSequestration of G15251227
22Tubulin-Homo sapiens-8Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
23ATP-sensitive inward rectifier potassium channel 1-Homo sapiensStimulation15251227 | 10990455
24Tubulin-Homo sapiens-15Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
25Cdc42-Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
26Tubulin-Homo sapiens-16Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
27Rho-Homo sapiens-1Recruitment to plasma membrane15251227
28Tubulin-Homo sapiens-2Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
29Rho-Homo sapiens-3Recruitment to plasma membrane15251227
30PI3K beta-Homo sapiensActivation9305878 | 12502714
31PI3K alpha-Homo sapiensPropable Inhibition16182515
32Adenylate cyclase 4-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
33Tubulin-Homo sapiens-22Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
34Tsk tyrosine kinase-Homo sapiensStimulation15251227 | 14671004
35Rac-Homo sapiens-2"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
36Voltage dependent N type calcium channel-Homo sapiensInhibition15251227 | 11031246
37Tubulin-Homo sapiens-11Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
38Calmodulin-Homo sapiensInhibition of calmodulin kinase15251227
39Tubulin-Homo sapiens-27Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
40Dynamin 1-Homo sapiensIncreased GTPase activity15251227 | 14671004
41ATP-sensitive inward rectifier potassium channel 12-Homo sapiensStimulation15251227 | 10990455
42Phospholipase C beta 2-Homo sapiensStimulation15251227 | 11015615 | 8383116
43Voltage dependent R type calcium channel-Homo sapiensInhibition15251227 | 11031246
44Tubulin-Homo sapiens-4Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
45Tubulin-Homo sapiens-25Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
46Adenylate cyclase 1-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933 | 10449730
47ATP-sensitive inward rectifier potassium channel 10-Homo sapiensStimulation15251227 | 10990455
48Tubulin-Homo sapiens-1Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
49SHC transforming protein 2-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
50GRK2-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
51Ras specific nucleotide exchange factor CDC25-Homo sapiensStimulation (indirect activation of ras)15251227 | 8717044
52Adenylate cyclase 6-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
53Tubulin-Homo sapiens-17Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
54Tubulin-Homo sapiens-21Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
55Rho-Homo sapiens-2Recruitment to plasma membrane15251227
56Tubulin-Homo sapiens-13Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
57Phospholipase C beta 3-Homo sapiensStimulation15251227 | 11015615 | 8383116
58Tubulin-Homo sapiens-7Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
59SHC transforming protein 3-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
60Tubulin-Homo sapiens-12Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
61Tubulin-Homo sapiens-6Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
62Tubulin-Homo sapiens-24Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
63ATP-sensitive inward rectifier potassium channel 15-Homo sapiensStimulation15251227 | 10990455
64Protein kinase D-Homo sapiensStimulation15251227
65Tubulin-Homo sapiens-3Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
66ATP-sensitive inward rectifier potassium channel 11-Homo sapiensStimulation15251227 | 10990455
67Tubulin-Homo sapiens-23Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
68Tubulin-Homo sapiens-26Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
69Adenylate cyclase 5-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
Interacton with GPCRs:
Coupling with GPCRs
NoNameCouplingPubMed