Quick search:







Description Entry page for G-protein - 'Ggamma-t2_Homo sapiens'
ClassGgamma
FamilyGgamma
Sub-FamilyGgamma
TypeGgamma-t2
Cross References:
References
UniProtO14610 | B2R746
EMBLAF001160 | AF001159 | AF365870 | AF493876 | AK312839 | CH471109 | BC008663
InterProIPR015898 | IPR001770
PRODOMPD003783
GENEID2793
MIM603655
PRINTSPR00321
PFAMPF00631
Details:
Details
NameGgamma-t2_Homo sapiens
DescriptionRecName: Full=Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2;AltName: Full=G gamma-C;AltName: Full=G-gamma-8;AltName: Full=G-gamma-9;Flags: Precursor
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGNGT2 | GNG8,GNG9,GNGT
FunctionGuanine nucleotide-binding proteins (G proteins) ares involved as a modulator or transducer in various transmembranes signaling systems
Fragment0
Sequence
MAQDLSEKDLLKMEVEQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPF
KEKGGCLIS
Effectors:
Effectors
NoNameRegulationPubMed
1Tubulin-Homo sapiens-27Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
2Phospholipase C beta 3-Homo sapiensStimulation15251227 | 11015615 | 8383116
3Kinase suppressor of Ras(KSR)-Homo sapiensSequestration of Gbeta/gamma15251227
4Adenylate cyclase 4-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
5SHC transforming protein 1-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
6ATP-sensitive inward rectifier potassium channel 12-Homo sapiensStimulation15251227 | 10990455
7Tubulin-Homo sapiens-12Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
8SHC transforming protein 3-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
9Tubulin-Homo sapiens-26Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
10Raf1 protein kinase-Homo sapiensSequestration of G15251227
11Tubulin-Homo sapiens-3Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
12Cdc42-Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
13Tubulin-Homo sapiens-8Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
14Phospholipase C beta 2-Homo sapiensStimulation15251227 | 11015615 | 8383116
15Protein kinase D-Homo sapiensStimulation15251227
16Adenylate cyclase 1-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933 | 10449730
17Rac-Homo sapiens-3"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
18Rho-Homo sapiens-3Recruitment to plasma membrane15251227
19Adenylate cyclase 2-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
20Adenylate cyclase 5-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
21PI3K gamma-Homo sapiensActivation12502714
22Rac-Homo sapiens-1"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
23Tubulin-Homo sapiens-24Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
24Tubulin-Homo sapiens-13Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
25Rho-Homo sapiens-1Recruitment to plasma membrane15251227
26Tubulin-Homo sapiens-18Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
27PI3K beta-Homo sapiensActivation9305878 | 12502714
28ATP-sensitive inward rectifier potassium channel 1-Homo sapiensStimulation15251227 | 10990455
29PI3K alpha-Homo sapiensPropable Inhibition16182515
30Voltage dependent R type calcium channel-Homo sapiensInhibition15251227 | 11031246
31Tubulin-Homo sapiens-15Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
32Tubulin-Homo sapiens-17Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
33ATP-sensitive inward rectifier potassium channel 10-Homo sapiensStimulation15251227 | 10990455
34ATP-sensitive inward rectifier potassium channel 11-Homo sapiensStimulation15251227 | 10990455
35Tubulin-Homo sapiens-23Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
36Tubulin-Homo sapiens-20Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
37Adenylate cyclase 6-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
38Tubulin-Homo sapiens-7Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
39GRK2-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
40Ras specific nucleotide exchange factor CDC25-Homo sapiensStimulation (indirect activation of ras)15251227 | 8717044
41Phospholipase C beta 1-Homo sapiensStimulation15251227 | 11015615 | 8383116
42Voltage dependent N type calcium channel-Homo sapiensInhibition15251227 | 11031246
43Tubulin-Homo sapiens-16Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
44Voltage dependent P/Q type calcium channel-Homo sapiensInhibition15251227 | 11031246
45ATP-sensitive inward rectifier potassium channel 8-Homo sapiensStimulation15251227 | 10990455
46Rac-Homo sapiens-2"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
47Adenylate cyclase 7-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
48Tsk tyrosine kinase-Homo sapiensStimulation15251227 | 14671004
49Tubulin-Homo sapiens-11Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
50Tubulin-Homo sapiens-4Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
51GRK3-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
52Tubulin-Homo sapiens-22Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
53Tubulin-Homo sapiens-25Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
54Dynamin 1-Homo sapiensIncreased GTPase activity15251227 | 14671004
55Rho-Homo sapiens-2Recruitment to plasma membrane15251227
56ATP-sensitive inward rectifier potassium channel 14-Homo sapiensStimulation15251227 | 10990455
57SHC transforming protein 2-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
58Tubulin-Homo sapiens-10Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
59Tubulin-Homo sapiens-1Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
60Tubulin-Homo sapiens-9Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
61Tubulin-Homo sapiens-6Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
62Calmodulin-Homo sapiensInhibition of calmodulin kinase15251227
63Tubulin-Homo sapiens-14Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
64Tubulin-Homo sapiens-21Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
65Tubulin-Homo sapiens-2Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
66Brutons tyrosine kinase-Homo sapiensStimulation15251227 | 11698416
67Tubulin-Homo sapiens-19Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
68ATP-sensitive inward rectifier potassium channel 15-Homo sapiensStimulation15251227 | 10990455
69Tubulin-Homo sapiens-5Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
Interacton with GPCRs:
Coupling with GPCRs
NoNameCouplingPubMed