Quick search:







Description Entry page for G-protein - 'Ggamma-t2_Homo sapiens'
ClassGgamma
FamilyGgamma
Sub-FamilyGgamma
TypeGgamma-t2
Cross References:
References
UniProtO14610 | B2R746
EMBLAF001160 | AF001159 | AF365870 | AF493876 | AK312839 | CH471109 | BC008663
InterProIPR015898 | IPR001770
PRODOMPD003783
GENEID2793
MIM603655
PRINTSPR00321
PFAMPF00631
Details:
Details
NameGgamma-t2_Homo sapiens
DescriptionRecName: Full=Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2;AltName: Full=G gamma-C;AltName: Full=G-gamma-8;AltName: Full=G-gamma-9;Flags: Precursor
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGNGT2 | GNG8,GNG9,GNGT
FunctionGuanine nucleotide-binding proteins (G proteins) ares involved as a modulator or transducer in various transmembranes signaling systems
Fragment0
Sequence
MAQDLSEKDLLKMEVEQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPF
KEKGGCLIS
Effectors:
Effectors
NoNameRegulationPubMed
1Tubulin-Homo sapiens-25Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
2Rho-Homo sapiens-2Recruitment to plasma membrane15251227
3Tubulin-Homo sapiens-18Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
4ATP-sensitive inward rectifier potassium channel 10-Homo sapiensStimulation15251227 | 10990455
5Tubulin-Homo sapiens-23Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
6Tubulin-Homo sapiens-17Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
7Tubulin-Homo sapiens-9Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
8Tubulin-Homo sapiens-3Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
9SHC transforming protein 1-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
10Tubulin-Homo sapiens-20Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
11ATP-sensitive inward rectifier potassium channel 1-Homo sapiensStimulation15251227 | 10990455
12Protein kinase D-Homo sapiensStimulation15251227
13Rac-Homo sapiens-3"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
14Tubulin-Homo sapiens-2Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
15ATP-sensitive inward rectifier potassium channel 11-Homo sapiensStimulation15251227 | 10990455
16Tubulin-Homo sapiens-15Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
17Rho-Homo sapiens-3Recruitment to plasma membrane15251227
18Phospholipase C beta 2-Homo sapiensStimulation15251227 | 11015615 | 8383116
19Raf1 protein kinase-Homo sapiensSequestration of G15251227
20ATP-sensitive inward rectifier potassium channel 8-Homo sapiensStimulation15251227 | 10990455
21Adenylate cyclase 6-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
22PI3K beta-Homo sapiensActivation9305878 | 12502714
23Adenylate cyclase 5-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
24Tubulin-Homo sapiens-19Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
25Tubulin-Homo sapiens-6Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
26Ras specific nucleotide exchange factor CDC25-Homo sapiensStimulation (indirect activation of ras)15251227 | 8717044
27Dynamin 1-Homo sapiensIncreased GTPase activity15251227 | 14671004
28Calmodulin-Homo sapiensInhibition of calmodulin kinase15251227
29GRK3-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
30Cdc42-Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
31PI3K alpha-Homo sapiensPropable Inhibition16182515
32Rac-Homo sapiens-2"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
33Tubulin-Homo sapiens-7Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
34Tubulin-Homo sapiens-14Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
35Voltage dependent R type calcium channel-Homo sapiensInhibition15251227 | 11031246
36Tubulin-Homo sapiens-27Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
37Tubulin-Homo sapiens-21Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
38Tsk tyrosine kinase-Homo sapiensStimulation15251227 | 14671004
39Tubulin-Homo sapiens-26Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
40Voltage dependent P/Q type calcium channel-Homo sapiensInhibition15251227 | 11031246
41Adenylate cyclase 2-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
42ATP-sensitive inward rectifier potassium channel 14-Homo sapiensStimulation15251227 | 10990455
43ATP-sensitive inward rectifier potassium channel 15-Homo sapiensStimulation15251227 | 10990455
44Voltage dependent N type calcium channel-Homo sapiensInhibition15251227 | 11031246
45Tubulin-Homo sapiens-16Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
46PI3K gamma-Homo sapiensActivation12502714
47Tubulin-Homo sapiens-5Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
48Phospholipase C beta 1-Homo sapiensStimulation15251227 | 11015615 | 8383116
49Tubulin-Homo sapiens-22Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
50Tubulin-Homo sapiens-11Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
51Tubulin-Homo sapiens-10Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
52Tubulin-Homo sapiens-8Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
53Adenylate cyclase 1-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933 | 10449730
54Tubulin-Homo sapiens-4Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
55Kinase suppressor of Ras(KSR)-Homo sapiensSequestration of Gbeta/gamma15251227
56SHC transforming protein 3-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
57Tubulin-Homo sapiens-13Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
58Adenylate cyclase 4-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
59Rho-Homo sapiens-1Recruitment to plasma membrane15251227
60Tubulin-Homo sapiens-1Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
61Tubulin-Homo sapiens-24Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
62GRK2-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
63Adenylate cyclase 7-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
64ATP-sensitive inward rectifier potassium channel 12-Homo sapiensStimulation15251227 | 10990455
65Rac-Homo sapiens-1"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
66Tubulin-Homo sapiens-12Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
67Phospholipase C beta 3-Homo sapiensStimulation15251227 | 11015615 | 8383116
68SHC transforming protein 2-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
69Brutons tyrosine kinase-Homo sapiensStimulation15251227 | 11698416
Interacton with GPCRs:
Coupling with GPCRs
NoNameCouplingPubMed