Quick search:







Description Entry page for G-protein - 'Galpha-14_Homo sapiens'
ClassGalpha
FamilyGq/11
Sub-FamilyGalpha-14
TypeGalpha-14
Cross References:
References
UniProtO95837
EMBLAF105201 | AF493903 | BC027886
InterProIPR001019 | IPR000654
PRODOMPD000281
GENEID9630
MIM604397
PRINTSPR00318 | PR00442
PFAMPF00503
Details:
Details
NameGalpha-14_Homo sapiens
DescriptionRecName: Full=Guanine nucleotide-binding protein subunit alpha-14; Short=G-protein subunit alpha-14; Short=G alpha-14
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGNA1
FunctionGuanine nucleotide-binding proteins (G proteins) ares involved as modulators or transducers in various transmembranes signaling systems
Fragment0
Sequence
MAGCCCLSAEEKESQRISAEIERQLRRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHG
SGYSDEDRKGFTKLVYQNIFTAMQAMIRAMDTLRIQYVCEQNKENAQIIREVEVDKVSML
SREQVEAIKQLWQDPGIQECYDRRREYQLSDSAKYYLTDIDRIATPSFVPTQQDVLRVRV
PTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFESVTSIIFLVALSEYDQVLAECDN
ENRMEESKALFKTIITYPWFLNSSVILFLNKKDLLEEKIMYSHLISYFPEYTGPKQDVRA
ARDFILKLYQDQNPDKEKVIYSHFTCATDTDNIRFVFAAVKDTILQLNLREFNLV
Effectors:
Effectors
NoNameRegulationPubMed
1GRK2-Homo sapiensInhibits PLC-beta activation and blocks Gqa-mediated GLUT4 translocation and glucose uptake in 3T3 adipocytes15251227 | 14654303 | 16182515
2Phospholipase C beta 4-Homo sapiensStimulation of PLC-beta catalytic activity15251227 | 16182515 | 11015615
3Phospholipase C beta 2-Homo sapiensStimulation of PLC-beta catalytic activity15251227 | 16182515 | 11015615
4Phospholipase C beta 1-Homo sapiensStimulation of PLC-beta catalytic activity15251227 | 16182515 | 11015615
5Phospholipase C beta 3-Homo sapiensStimulation of PLC-beta catalytic activity15251227 | 16182515 | 11015615
Interacton with GPCRs:
Coupling with GPCRs
NoNameCouplingPubMed