Quick search:







Description Entry page for G-protein - 'Galpha-i1_Homo sapiens'
ClassGalpha
FamilyGi/o
Sub-FamilyGalpha-i
TypeGalpha-i1
Cross References:
References
UniProtP63096 | A8KA88 | P04898 | P11015 | P31871 | Q5U074 | Q8TAN5 | Q9UGA4
EMBLAF493905 | AF055013 | AL049933 | BT019775 | AK292953 | CH471091 | BC026326 | M20596 | M20594 | M20595 | M17219
InterProIPR001019 | IPR001408
PRODOMPD000281
GENEID2770
MIM139310
PRINTSPR00318 | PR00441
PFAMPF00503
Details:
Details
NameGalpha-i1_Homo sapiens
Description"RecName: Full=Guanine nucleotide-binding protein G(i), alpha-1 subunit;AltName: Full=Adenylate cyclase-inhibiting G alpha protein;"
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGNAI
FunctionGuanine nucleotide-binding proteins (G proteins) ares involved as modulators or transducers in various transmembranes signaling systems
Fragment0
Sequence
MGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAG
YSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLAGAAEEGFMT
AELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVK
TTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEM
NRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAA
AYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF
Effectors:
Effectors
NoNameRegulationPubMed
1Tubulin-Homo sapiens-17Stimulation of GTPase activity10224115 | 15251227 | 16380086
2Tubulin-Homo sapiens-6Stimulation of GTPase activity10224115 | 15251227 | 16380086
3Tubulin-Homo sapiens-3Stimulation of GTPase activity10224115 | 15251227 | 16380086
4Tubulin-Homo sapiens-26Stimulation of GTPase activity10224115 | 15251227 | 16380086
5Rap1GAPII-Homo sapiens-1Sequestration of RAP1GAP10476970 | 15251227
6Tubulin-Homo sapiens-18Stimulation of GTPase activity10224115 | 15251227 | 16380086
7Tubulin-Homo sapiens-14Stimulation of GTPase activity10224115 | 15251227 | 16380086
8Tubulin-Homo sapiens-7Stimulation of GTPase activity10224115 | 15251227 | 16380086
9Rap1GAPII-Homo sapiens-2Sequestration of RAP1GAP10476970 | 15251227
10G-protein-regulated inducer of neurite outgrowth GRIN2-Homo sapiensUnknown15251227 | 10480904 | 14671004
11Tubulin-Homo sapiens-16Stimulation of GTPase activity10224115 | 15251227 | 16380086
12Adenylate cyclase 1-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
13Tubulin-Homo sapiens-4Stimulation of GTPase activity10224115 | 15251227 | 16380086
14G-protein-regulated inducer of neurite outgrowth GRIN1-Homo sapiensUnknown15251227 | 10480904 | 14671004
15Tubulin-Homo sapiens-27Stimulation of GTPase activity10224115 | 15251227 | 16380086
16Tubulin-Homo sapiens-25Stimulation of GTPase activity10224115 | 15251227 | 16380086
17Src tyrosine kinase-Homo sapiens-1Stimulation11007482 | 15251227 | 12209124
18Adenylate cyclase 5-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
19Tubulin-Homo sapiens-22Stimulation of GTPase activity10224115 | 15251227 | 16380086
20Tubulin-Homo sapiens-5Stimulation of GTPase activity10224115 | 15251227 | 16380086
21Tubulin-Homo sapiens-12Stimulation of GTPase activity10224115 | 15251227 | 16380086
22Tubulin-Homo sapiens-19Stimulation of GTPase activity10224115 | 15251227 | 16380086
23Tubulin-Homo sapiens-13Stimulation of GTPase activity10224115 | 15251227 | 16380086
24Rac-Homo sapiens-1Stimulation11099498
25Tubulin-Homo sapiens-2Stimulation of GTPase activity10224115 | 15251227 | 16380086
26Rac-Homo sapiens-2Stimulation11099498
27Tubulin-Homo sapiens-21Stimulation of GTPase activity10224115 | 15251227 | 16380086
28Tubulin-Homo sapiens-10Stimulation of GTPase activity10224115 | 15251227 | 16380086
29Tubulin-Homo sapiens-8Stimulation of GTPase activity10224115 | 15251227 | 16380086
30Tubulin-Homo sapiens-1Stimulation of GTPase activity10224115 | 15251227 | 16380086
31Tubulin-Homo sapiens-15Stimulation of GTPase activity10224115 | 15251227 | 16380086
32Tubulin-Homo sapiens-20Stimulation of GTPase activity10224115 | 15251227 | 16380086
33Tubulin-Homo sapiens-9Stimulation of GTPase activity10224115 | 15251227 | 16380086
34Tubulin-Homo sapiens-11Stimulation of GTPase activity10224115 | 15251227 | 16380086
35Tubulin-Homo sapiens-23Stimulation of GTPase activity10224115 | 15251227 | 16380086
36Src tyrosine kinase-Homo sapiens-2Stimulation11007482 | 15251227 | 12209124
37Cdc42-Homo sapiensStimulation11099498
38Tubulin-Homo sapiens-24Stimulation of GTPase activity10224115 | 15251227 | 16380086
39Adenylate cyclase 6-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
40Rac-Homo sapiens-3Stimulation11099498
Interacton with GPCRs:
Coupling with GPCRs
NoNameCouplingPubMed