Quick search:







Description Entry page for G-protein - 'Galpha-i2_Homo sapiens'
ClassGalpha
FamilyGi/o
Sub-FamilyGalpha-i
TypeGalpha-i2
Cross References:
References
UniProtP04899 | Q8IZ71
EMBLX04828 | J03004 | M20593 | M20586 | M20587 | M20588 | M20589 | M20590 | M20591 | M20592 | AF493906 | BC012138 | BC016995 | X07854
InterProIPR001019 | IPR001408
PRODOMPD000281
GENEID2771
MIM139360
PRINTSPR00318 | PR00441
PFAMPF00503
Details:
Details
NameGalpha-i2_Homo sapiens
Description"RecName: Full=Guanine nucleotide-binding protein G(i), alpha-2 subunit;AltName: Full=Adenylate cyclase-inhibiting G alpha protein;"
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGNAI2 | GNAI2
FunctionGuanine nucleotide-binding proteins (G proteins) ares involved as modulators or transducers in various transmembranes signaling systems
Fragment0
Sequence
MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDG
YSEEECRQYRAVVYSNTIQSIMAIVKAMGNLQIDFADPSRADDARQLFALSCTAEEQGVL
PDDLSGVIRRLWADHGVQACFGRSREYQLNDSAAYYLNDLERIAQSDYIPTQQDVLRTRV
KTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEE
MNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKITHSPLTICFPEYTGANKYDEA
ASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF
Effectors:
Effectors
NoNameRegulationPubMed
1Adenylate cyclase 1-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
2Tubulin-Homo sapiens-27Stimulation of GTPase activity10224115 | 15251227 | 16380086
3Rac-Homo sapiens-1Stimulation11099498
4Tubulin-Homo sapiens-1Stimulation of GTPase activity10224115 | 15251227 | 16380086
5G-protein-regulated inducer of neurite outgrowth GRIN1-Homo sapiensUnknown15251227 | 10480904 | 14671004
6Tubulin-Homo sapiens-11Stimulation of GTPase activity10224115 | 15251227 | 16380086
7Cdc42-Homo sapiensStimulation11099498
8Src tyrosine kinase-Homo sapiens-1Stimulation11007482 | 15251227 | 12209124
9Tubulin-Homo sapiens-18Stimulation of GTPase activity10224115 | 15251227 | 16380086
10Tubulin-Homo sapiens-3Stimulation of GTPase activity10224115 | 15251227 | 16380086
11Adenylate cyclase 5-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
12Tubulin-Homo sapiens-12Stimulation of GTPase activity10224115 | 15251227 | 16380086
13Rac-Homo sapiens-2Stimulation11099498
14Tubulin-Homo sapiens-22Stimulation of GTPase activity10224115 | 15251227 | 16380086
15Tubulin-Homo sapiens-7Stimulation of GTPase activity10224115 | 15251227 | 16380086
16Tubulin-Homo sapiens-25Stimulation of GTPase activity10224115 | 15251227 | 16380086
17Tubulin-Homo sapiens-16Stimulation of GTPase activity10224115 | 15251227 | 16380086
18G-protein-regulated inducer of neurite outgrowth GRIN2-Homo sapiensUnknown15251227 | 10480904 | 14671004
19Tubulin-Homo sapiens-17Stimulation of GTPase activity10224115 | 15251227 | 16380086
20Rap1GAPII-Homo sapiens-1Sequestration of RAP1GAP10476970 | 15251227
21Adenylate cyclase 6-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
22Tubulin-Homo sapiens-5Stimulation of GTPase activity10224115 | 15251227 | 16380086
23Tubulin-Homo sapiens-26Stimulation of GTPase activity10224115 | 15251227 | 16380086
24Tubulin-Homo sapiens-9Stimulation of GTPase activity10224115 | 15251227 | 16380086
25Rac-Homo sapiens-3Stimulation11099498
26Tubulin-Homo sapiens-10Stimulation of GTPase activity10224115 | 15251227 | 16380086
27Tubulin-Homo sapiens-20Stimulation of GTPase activity10224115 | 15251227 | 16380086
28Tubulin-Homo sapiens-23Stimulation of GTPase activity10224115 | 15251227 | 16380086
29Tubulin-Homo sapiens-21Stimulation of GTPase activity10224115 | 15251227 | 16380086
30Tubulin-Homo sapiens-6Stimulation of GTPase activity10224115 | 15251227 | 16380086
31Src tyrosine kinase-Homo sapiens-2Stimulation11007482 | 15251227 | 12209124
32Tubulin-Homo sapiens-4Stimulation of GTPase activity10224115 | 15251227 | 16380086
33Tubulin-Homo sapiens-15Stimulation of GTPase activity10224115 | 15251227 | 16380086
34Tubulin-Homo sapiens-19Stimulation of GTPase activity10224115 | 15251227 | 16380086
35Tubulin-Homo sapiens-8Stimulation of GTPase activity10224115 | 15251227 | 16380086
36Rap1GAPII-Homo sapiens-2Sequestration of RAP1GAP10476970 | 15251227
37Tubulin-Homo sapiens-13Stimulation of GTPase activity10224115 | 15251227 | 16380086
38Tubulin-Homo sapiens-2Stimulation of GTPase activity10224115 | 15251227 | 16380086
39Tubulin-Homo sapiens-24Stimulation of GTPase activity10224115 | 15251227 | 16380086
40Tubulin-Homo sapiens-14Stimulation of GTPase activity10224115 | 15251227 | 16380086
Interacton with GPCRs:
Coupling with GPCRs
NoNameCouplingPubMed