Quick search:







Description Entry page for G-protein - 'Galpha-i3_Homo sapiens'
ClassGalpha
FamilyGi/o
Sub-FamilyGalpha-i
TypeGalpha-i3
Cross References:
References
UniProtP08754 | P17539
EMBLM27543 | J03005 | M20604 | M20597 | M20598 | M20599 | M20600 | M20601 | M20602 | M20603 | J03198 | J03238 | AF493907 | BT019974 | BC025285
InterProIPR001019 | IPR001408
PRODOMPD000281
GENEID2773
MIM139370
PRINTSPR00318 | PR00441
PFAMPF00503
Details:
Details
NameGalpha-i3_Homo sapiens
DescriptionRecName: Full=Guanine nucleotide-binding protein G(k) subunit alpha;AltName: Full=G(i) alpha-3
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGNAI
FunctionGuanine nucleotide-binding proteins (G proteins) ares involved as modulators or transducers in various transmembranes signaling systems
Fragment0
Sequence
MGCTLSAEDKAAVERSKMIDRNLREDGEKAAKEVKLLLLGAGESGKSTIVKQMKIIHEDG
YSEDECKQYKVVVYSNTIQSIIAIIRAMGRLKIDFGEAARADDARQLFVLAGSAEEGVMT
PELAGVIKRLWRDGGVQACFSRSREYQLNDSASYYLNDLDRISQSNYIPTQQDVLRTRVK
TTGIVETHFTFKDLYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEM
NRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEEKIKRSPLTICYPEYTGSNTYEEAA
AYIQCQFEDLNRRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKECGLY
Effectors:
Effectors
NoNameRegulationPubMed
1Tubulin-Homo sapiens-21Stimulation of GTPase activity10224115 | 15251227 | 16380086
2Tubulin-Homo sapiens-24Stimulation of GTPase activity10224115 | 15251227 | 16380086
3Tubulin-Homo sapiens-2Stimulation of GTPase activity10224115 | 15251227 | 16380086
4G-protein-regulated inducer of neurite outgrowth GRIN1-Homo sapiensUnknown15251227 | 10480904 | 14671004
5Tubulin-Homo sapiens-9Stimulation of GTPase activity10224115 | 15251227 | 16380086
6Tubulin-Homo sapiens-4Stimulation of GTPase activity10224115 | 15251227 | 16380086
7Tubulin-Homo sapiens-12Stimulation of GTPase activity10224115 | 15251227 | 16380086
8Tubulin-Homo sapiens-19Stimulation of GTPase activity10224115 | 15251227 | 16380086
9Tubulin-Homo sapiens-1Stimulation of GTPase activity10224115 | 15251227 | 16380086
10Rac-Homo sapiens-2Stimulation11099498
11Adenylate cyclase 6-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
12Src tyrosine kinase-Homo sapiens-2Stimulation11007482 | 15251227 | 12209124
13Tubulin-Homo sapiens-14Stimulation of GTPase activity10224115 | 15251227 | 16380086
14Tubulin-Homo sapiens-23Stimulation of GTPase activity10224115 | 15251227 | 16380086
15Tubulin-Homo sapiens-5Stimulation of GTPase activity10224115 | 15251227 | 16380086
16Rac-Homo sapiens-3Stimulation11099498
17Rap1GAPII-Homo sapiens-1Sequestration of RAP1GAP10476970 | 15251227
18Tubulin-Homo sapiens-27Stimulation of GTPase activity10224115 | 15251227 | 16380086
19Tubulin-Homo sapiens-17Stimulation of GTPase activity10224115 | 15251227 | 16380086
20Tubulin-Homo sapiens-10Stimulation of GTPase activity10224115 | 15251227 | 16380086
21Tubulin-Homo sapiens-8Stimulation of GTPase activity10224115 | 15251227 | 16380086
22Tubulin-Homo sapiens-26Stimulation of GTPase activity10224115 | 15251227 | 16380086
23Tubulin-Homo sapiens-3Stimulation of GTPase activity10224115 | 15251227 | 16380086
24Rap1GAPII-Homo sapiens-2Sequestration of RAP1GAP10476970 | 15251227
25Tubulin-Homo sapiens-6Stimulation of GTPase activity10224115 | 15251227 | 16380086
26Tubulin-Homo sapiens-22Stimulation of GTPase activity10224115 | 15251227 | 16380086
27Src tyrosine kinase-Homo sapiens-1Stimulation11007482 | 15251227 | 12209124
28Cdc42-Homo sapiensStimulation11099498
29Tubulin-Homo sapiens-20Stimulation of GTPase activity10224115 | 15251227 | 16380086
30Adenylate cyclase 1-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
31Tubulin-Homo sapiens-18Stimulation of GTPase activity10224115 | 15251227 | 16380086
32Tubulin-Homo sapiens-25Stimulation of GTPase activity10224115 | 15251227 | 16380086
33Rac-Homo sapiens-1Stimulation11099498
34Tubulin-Homo sapiens-15Stimulation of GTPase activity10224115 | 15251227 | 16380086
35G-protein-regulated inducer of neurite outgrowth GRIN2-Homo sapiensUnknown15251227 | 10480904 | 14671004
36Adenylate cyclase 5-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
37Tubulin-Homo sapiens-7Stimulation of GTPase activity10224115 | 15251227 | 16380086
38Tubulin-Homo sapiens-11Stimulation of GTPase activity10224115 | 15251227 | 16380086
39Tubulin-Homo sapiens-16Stimulation of GTPase activity10224115 | 15251227 | 16380086
40Tubulin-Homo sapiens-13Stimulation of GTPase activity10224115 | 15251227 | 16380086
Interacton with GPCRs:
Coupling with GPCRs
NoNameCouplingPubMed